TkA07G444170 | RubberDandelionOmics

Gene overview

TkA07G444170

Reference: TK1151 Chr: Chr07 Coordinates: 112683273-112685005 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1646 bp · TkA07G444170|TK1151|cDNA

ATAATCCGTACAACTCATAACCAACTGTGCTTATATAAATCCATCATCCCACACGTTACTTCCTACACTCCTCTCCTCCATCTTCGCCGCTCAAAATCCTATCCGAGTTCGCCGGCCGTTGCAAATAACATTTCAATTCTGTGTATGGCAGCTCGTTTACTGGCACATGAGGTAGCTGACCTCTGTCTCGGCAAGCCGCCGTTGAAATCGCTCCCAATCTCCGCCACCGTTAGCCACGCCCTCAACGTTCTTAAGTCCGC...

CDS

Download CDS FASTA

1353 bp · TkA07G444170|TK1151|CDS

ATAATCCGTACAACTCATAACCAACTGTGCTTATATAAATCCATCATCCCACACGTTACTTCCTACACTCCTCTCCTCCATCTTCGCCGCTCAAAATCCTATCCGAGTTCGCCGGCCGTTGCAAATAACATTTCAATTCTGTGTATGGCAGCTCGTTTACTGGCACATGAGGTAGCTGACCTCTGTCTCGGCAAGCCGCCGTTGAAATCGCTCCCAATCTCCGCCACCGTTAGCCACGCCCTCAACGTTCTTAAGTCCGC...

Protein

Download Protein FASTA

450 aa · TkA07G444170|TK1151|PROTEIN

IIRTTHNQLCLYKSIIPHVTSYTPLLHLRRSKSYPSSPAVANNISILCMAARLLAHEVADLCLGKPPLKSLPISATVSHALNVLKSADDDTHISIWTCDHHQTAQPLANNCLCVGKICMVDIICFLCKEDNIRSPSSALDSPVSVLLSGDPDIVRHVNPSDSLIEVIDLIIGGAQNLIVPINRKTIINSKRKQNLQRGKSIAPTTHFAGGEFCWLTQEDVIRFLLSSIALFSPTVAYSVESLGIISSDIFTVNYHSPAST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G444170`
TK1151 ID	TkA07G444170
OH-1004 ID	LXL04_030996
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 89.778 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G444170

Location Chr07:112683273-112685005 (+)

Description Similar to CBSX5: CBS domain-containing protein CBSX5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27460`	CBS domain-containing protein CBSX5.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030996 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071456 cellular response to hypoxia Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

KEGG gene cross-reference

ath:AT1G65320

ath:AT4G27460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.398

Rank 1 · TkA07G444170 · TK1151

Cytoplasm0.366

Rank 2 · TkA07G444170 · TK1151

Cell membrane0.142

Rank 3 · TkA07G444170 · TK1151

Lysosome / Vacuole0.092

Rank 4 · TkA07G444170 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA07G444170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00571CBS65-85 aa

PF00571CBS156-170 aa

PF00571CBS215-225 aa

PF00571CBS244-289 aa

PF00571CBS395-441 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G444170	`PF00571`	CBS	65	85	1.7e-09	38.5
TkA07G444170	`PF00571`	CBS	156	170	1.7e-09	38.5
TkA07G444170	`PF00571`	CBS	215	225	1.7e-09	38.5
TkA07G444170	`PF00571`	CBS	244	289	1.7e-09	38.5
TkA07G444170	`PF00571`	CBS	395	441	1.7e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WQ5`	Arabidopsis thaliana	sp\|Q84WQ5\|CBSX5_ARATH CBS domain-containing protein CBSX5	50.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card