TkA07G443010 | RubberDandelionOmics

Gene overview

TkA07G443010

Reference: TK1151 Chr: Chr07 Coordinates: 112280575-112283079 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2088 bp · TkA07G443010|TK1151|cDNA

ATGAGTTTCCTGAAGTGGGTTCCTTTAGTTCTCACATTTGTTCTTCAGTCGTATGCTTCATTCAGTCCTGTAGACCGCTACTTAATCGCTTGTGGTTCTTCTCAAAACATCACTTATCTTGGTCAGACATATGTTCCTGATTCAGACAAATCATCAATGATAGCTCTGAATAACCACCAGACTTCAGAAATACTCATTTCCAATTCCACCGTCCCGTTACCCATCCACCAATCCGCCCGAGTGTTCACCAGCACCGCCTC...

CDS

Download CDS FASTA

2088 bp · TkA07G443010|TK1151|CDS

ATGAGTTTCCTGAAGTGGGTTCCTTTAGTTCTCACATTTGTTCTTCAGTCGTATGCTTCATTCAGTCCTGTAGACCGCTACTTAATCGCTTGTGGTTCTTCTCAAAACATCACTTATCTTGGTCAGACATATGTTCCTGATTCAGACAAATCATCAATGATAGCTCTGAATAACCACCAGACTTCAGAAATACTCATTTCCAATTCCACCGTCCCGTTACCCATCCACCAATCCGCCCGAGTGTTCACCAGCACCGCCTC...

Protein

Download Protein FASTA

695 aa · TkA07G443010|TK1151|PROTEIN

MSFLKWVPLVLTFVLQSYASFSPVDRYLIACGSSQNITYLGQTYVPDSDKSSMIALNNHQTSEILISNSTVPLPIHQSARVFTSTASYEFDIKKQGRHWVRLYFFPIPSDHHLTAASFSVVTENFVLLNNYTFKNYSGSSHLFREYSINVTSDTLLLNFIPANSSIAFINAIEVTSIPDIMIPDEATFVYPSNTISGLSDHAFETIHRLNMGGPKLTPQNDTLGRTWENDAKYLHVNGSAANVSINPSMVKYMDSLTPEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G443010`
TK1151 ID	TkA07G443010
OH-1004 ID	LXL04_016453
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	60.300
Protein coverage (%)	TK1151 97.698 / OH-1004 97.417 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G443010

Location Chr07:112280575-112283079 (-)

Description Similar to THE1: Receptor-like protein kinase THESEUS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21480

ath:AT3G46290

ath:AT5G54380

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.757

Rank 1 · TkA07G443010 · TK1151

Endoplasmic reticulum0.098

Rank 2 · TkA07G443010 · TK1151

Cytoplasm0.089

Rank 3 · TkA07G443010 · TK1151

Lysosome / Vacuole0.070

Rank 4 · TkA07G443010 · TK1151

Nucleus0.051

Rank 5 · TkA07G443010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11721Malectin28-165 aa

PF12819Malectin_like29-380 aa

PF11721Malectin206-338 aa

PF03109ABC1479-518 aa

PF00069Pkinase484-573 aa

PF07714PK_Tyr_Ser-Thr486-568 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G443010	`PF11721`	Malectin	28	165	2.7e-14	54.2
TkA07G443010	`PF12819`	Malectin_like	29	380	8.4e-29	101.6
TkA07G443010	`PF11721`	Malectin	206	338	2.7e-14	54.2
TkA07G443010	`PF03109`	ABC1	479	518	0.2	11.5
TkA07G443010	`PF00069`	Pkinase	484	573	2e-14	54.4
TkA07G443010	`PF07714`	PK_Tyr_Ser-Thr	486	568	7.9e-17	62.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	52.700%	Swiss-Prot	High
`Q9SJT0`	Arabidopsis thaliana	sp\|Q9SJT0\|Y2214_ARATH Probable receptor-like protein kinase At2g21480	39.600%	Swiss-Prot	Medium
`Q9T020`	Arabidopsis thaliana	sp\|Q9T020\|Y4391_ARATH Probable receptor-like protein kinase At4g39110	38.600%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	39.000%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card