TkA07G441760 | RubberDandelionOmics

Gene overview

TkA07G441760

Reference: TK1151 Chr: Chr07 Coordinates: 111909685-111911431 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1620 bp · TkA07G441760|TK1151|cDNA

ATTCCATTGGCCAAAATTAATTGTCCAAACGAGTATATATATACAAACGTAAAACCAAAACTTCTACCAGATCTTTTTCAACATCCGCCACTCTTTGATCGTCTTCCAGATACAATTTATTCCGGAAGCAATGGCCGGTCGAGGCAAAACCCTAGGATCCTCCGGAGCAGCAAAGAAGGCCACTTCAAGAAGTAGCAAAGCCGGTCTTCAGTTTCCGGTAGGTCGTATCGCCCGTTTTCTGAAAGCCGGCAAGTACGCCG...

CDS

Download CDS FASTA

405 bp · TkA07G441760|TK1151|CDS

ATGGCCGGTCGAGGCAAAACCCTAGGATCCTCCGGAGCAGCAAAGAAGGCCACTTCAAGAAGTAGCAAAGCCGGTCTTCAGTTTCCGGTAGGTCGTATCGCCCGTTTTCTGAAAGCCGGCAAGTACGCCGAACGTGTAGGTGCCGGAGCTCCCGTCTACCTCGCCGCCGTCCTCGAATATCTAGCTGCCGAAGTTCTCGAGTTAGCTGGAAACGCTGCAAGGGACAACAAGAAGACGAGAATCGTGCCTAGACACATCCA...

Protein

Download Protein FASTA

134 aa · TkA07G441760|TK1151|PROTEIN

MAGRGKTLGSSGAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKAPGSSKPSADDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G441760`
TK1151 ID	TkA07G441760
OH-1004 ID	LXL04_037532
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 100.000 / OH-1004 70.157 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G441760

Location Chr07:111909685-111911431 (-)

Description Similar to At4g27230: Probable histone H2A.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51060`	Core component of nucleosome.	No verified direct reference in this release
`At5g54640`	Core component of nucleosome.	An Arabidopsis histone H2A mutant is deficient in Agrobacterium T-DNA integration.2000 · DOI: 10.1073/pnas.97.2.948 Expression of the Arabidopsis histone H2A-1 gene correlates with susceptibility to Agrobacterium transformation.2002 · DOI: 10.1046/j.1365-313x.2002.01425.x
`At4g27230`	Core component of nucleosome.	No verified direct reference in this release
`At3g20670`	Core component of nucleosome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YVE5`	Core component of nucleosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037532 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009294 DNA-mediated transformation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030527 structural constituent of chromatin Molecular Function

KEGG gene cross-reference

ath:AT1G51060

ath:AT3G20670

ath:AT4G27230

ath:AT5G54640

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA07G441760 · TK1151

Cytoplasm0.079

Rank 2 · TkA07G441760 · TK1151

Extracellular0.013

Rank 3 · TkA07G441760 · TK1151

Cell membrane0.013

Rank 4 · TkA07G441760 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA07G441760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26281Histone_ABTB11-56 aa

PF00125Histone15-91 aa

PF00808CBFD_NFYB_HMF27-90 aa

PF22703Cdc6_lid37-47 aa

PF22703Cdc6_lid62-89 aa

PF16211Histone_H2A_C94-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G441760	`PF26281`	Histone_ABTB	11	56	0.00013	22.3
TkA07G441760	`PF00125`	Histone	15	91	4.1e-14	53.4
TkA07G441760	`PF00808`	CBFD_NFYB_HMF	27	90	2.4e-05	25.3
TkA07G441760	`PF22703`	Cdc6_lid	37	47	0.031	14.9
TkA07G441760	`PF22703`	Cdc6_lid	62	89	0.031	14.9
TkA07G441760	`PF16211`	Histone_H2A_C	94	128	2.7e-18	66.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C681`	Arabidopsis thaliana	sp\|Q9C681\|H2A1_ARATH Probable histone H2A.1	94.000%	Swiss-Prot	High
`Q9LD28`	Arabidopsis thaliana	sp\|Q9LD28\|H2A6_ARATH Histone H2A.6	95.500%	Swiss-Prot	High
`O81826`	Arabidopsis thaliana	sp\|O81826\|H2A3_ARATH Probable histone H2A.3	94.700%	Swiss-Prot	High
`Q9LHQ5`	Arabidopsis thaliana	sp\|Q9LHQ5\|H2A2_ARATH Probable histone H2A.2	93.300%	Swiss-Prot	High
`A2YVE5`	Oryza sativa subsp. indica	sp\|A2YVE5\|H2A3_ORYSI Probable histone H2A.3	91.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card