TkA07G441740 | RubberDandelionOmics

Gene overview

TkA07G441740

Reference: TK1151 Chr: Chr07 Coordinates: 111902480-111904129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

847 bp · TkA07G441740|TK1151|cDNA

TAAAGGCCCAAGTTACAGATCTTGCTAAGGAAATATTACTAAAATACCCTCAGTTTAGGATGTCGATTTCGTGGCGGGTAACTCCCAAGTCCCAACAATCTTCCATCAACCCCATAATACTCTTATCAGCTAAGCATCACCGCCACCATCAACCATGTCTCCGACGGCAAACCTGAACCAAATTTTCAGCACTTTTCCGGCGATCCCAAAACTTTCCGGCGATGGAAAGCCCCGGCCAGATGCAGCTACACCCCGATTCA...

CDS

Download CDS FASTA

666 bp · TkA07G441740|TK1151|CDS

ATGTCTCCGACGGCAAACCTGAACCAAATTTTCAGCACTTTTCCGGCGATCCCAAAACTTTCCGGCGATGGAAAGCCCCGGCCAGATGCAGCTACACCCCGATTCACTGGAAACAATGCGGAGGAAAATCAAAACCACCACCCATTAAAACCAACAAGAAGACTCGCATTAGGACTCAGCTCTATGGGACTCTTTGCAAATTCCAACATTGCAGCTGTTCTTGCGGAGGATAACGGTTTCTGGCTCACCGGACCTATTCC...

Protein

Download Protein FASTA

221 aa · TkA07G441740|TK1151|PROTEIN

MSPTANLNQIFSTFPAIPKLSGDGKPRPDAATPRFTGNNAEENQNHHPLKPTRRLALGLSSMGLFANSNIAAVLAEDNGFWLTGPIPIPRALNMIDNVDTGTRSFLKTGVYIADIGTKGRQFRLKKYAFDLLALGDLIGKDAWNYVRKYLRLKSTFMYFDFDKVISAATSDEKPPLLDLANRLFNTVEKLEDAVKKQDLPQTELLFKDTTVILEEVMTKMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G441740`
TK1151 ID	TkA07G441740
OH-1004 ID	LXL04_030965
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G441740

Location Chr07:111902480-111904129 (+)

Description Similar to PNSL3: Photosynthetic NDH subunit of lumenal location 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01440`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	Three PsbQ-like proteins are required for the function of the chloroplast NAD(P)H dehydrogenase complex in Arabidopsis.2010 · DOI: 10.1093/pcp/pcq060

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030965 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0019684 photosynthesis, light reaction Biological Process

GO:0005829 cytosol Cellular Component

GO:0009344 nitrite reductase complex [NAD(P)H] Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

KEGG gene cross-reference

ath:AT3G01440

ath:AT4G05180

ath:AT4G21280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · TkA07G441740 · TK1151

Mitochondrion0.018

Rank 2 · TkA07G441740 · TK1151

Nucleus0.011

Rank 3 · TkA07G441740 · TK1151

Cytoplasm0.010

Rank 4 · TkA07G441740 · TK1151

Cell membrane0.009

Rank 5 · TkA07G441740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05757PsbQ34-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G441740	`PF05757`	PsbQ	34	221	4.6e-50	171.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGH4`	Arabidopsis thaliana	sp\|Q9SGH4\|PNSL3_ARATH Photosynthetic NDH subunit of lumenal location 3, chloroplastic	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card