TkA07G441360 | RubberDandelionOmics

Gene overview

TkA07G441360

Reference: TK1151 Chr: Chr07 Coordinates: 111789446-111790105 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

660 bp · TkA07G441360|TK1151|cDNA

ATGTCCGACTACGACCGCCACGACGGCGGAGCAGCCTGCTGCAGGTGTTGTTTCAGCTTCATACTAACCTTAGGTCTCGCCGCCCTCTTTCTATGGCTAAGCTTACGCACTTCAAATCCAGTTTGCTCCATCCAAGACGTTTACATTCCCGCTCTCAACAAAACTCGAAATTCAACCTCCTATCAGTCCATCTACCTCGATCTGAAGCTCGACAACGAGAACAAAGACAAAGGTATTTACTACGATCAACTCAACATCAC...

CDS

Download CDS FASTA

660 bp · TkA07G441360|TK1151|CDS

ATGTCCGACTACGACCGCCACGACGGCGGAGCAGCCTGCTGCAGGTGTTGTTTCAGCTTCATACTAACCTTAGGTCTCGCCGCCCTCTTTCTATGGCTAAGCTTACGCACTTCAAATCCAGTTTGCTCCATCCAAGACGTTTACATTCCCGCTCTCAACAAAACTCGAAATTCAACCTCCTATCAGTCCATCTACCTCGATCTGAAGCTCGACAACGAGAACAAAGACAAAGGTATTTACTACGATCAACTCAACATCAC...

Protein

Download Protein FASTA

219 aa · TkA07G441360|TK1151|PROTEIN

MSDYDRHDGGAACCRCCFSFILTLGLAALFLWLSLRTSNPVCSIQDVYIPALNKTRNSTSYQSIYLDLKLDNENKDKGIYYDQLNITLHYYINESISNHEKTGIQISNYTLKGFYQGHQKKARRKNWTDTYGVPWDVALNGGPAVFRVDLVTAVRFKILFWKTKRHGLRVGADFEVSDRGQKVQKKGTRLKSGAPELFSGNSRVTSSLVVFCTFVLVFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G441360`
TK1151 ID	TkA07G441360
OH-1004 ID	LXL04_030957
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G441360

Location Chr07:111789446-111790105 (+)

Description Similar to NDR1: Protein NDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20600`	Involved in disease resistance.	NDR1, a locus of Arabidopsis thaliana that is required for disease resistance to both a bacterial and a fungal pathogen.1995 · DOI: 10.1073/pnas.92.14.6597 The role of NDR1 in avirulence gene-directed signaling and control of programmed cell death in Arabidopsis.2001 · PMID: 11706189 Overexpression of the plasma membrane-localized NDR1 protein results in enhanced bacterial disease resistance in Arabidopsis thaliana.2004 · DOI: 10.1111/j.1365-313x.2004.02203.x Early responses in the Arabidopsis-Verticillium longisporum pathosystem are dependent on NDR1, JA- and ET-associated signals via cytosolic NPR1 and RFO1.2006 · DOI: 10.1094/mpmi-19-0958 NDR1 interaction with RIN4 mediates the differential activation of multiple disease resistance pathways in Arabidopsis.2006 · DOI: 10.1105/tpc.106.044693

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030957 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051607 defense response to virus Biological Process

GO:0051707 response to other organism Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G35980

ath:AT3G20600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.703

Rank 1 · TkA07G441360 · TK1151

Cytoplasm0.121

Rank 2 · TkA07G441360 · TK1151

Endoplasmic reticulum0.099

Rank 3 · TkA07G441360 · TK1151

Lysosome / Vacuole0.095

Rank 4 · TkA07G441360 · TK1151

Extracellular0.074

Rank 5 · TkA07G441360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21908Cel124_C89-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G441360	`PF21908`	Cel124_C	89	131	0.019	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48915`	Arabidopsis thaliana	sp\|O48915\|NDR1_ARATH Protein NDR1	47.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card