TkA07G438120 | RubberDandelionOmics

Gene overview

TkA07G438120

Reference: TK1151 Chr: Chr07 Coordinates: 110925227-110929737 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · TkA07G438120|TK1151|cDNA

AACCCATTCCCCCCTTCTTGAATTACATGTTTTCTTGAGCGAAAAGAAATACAAGAACGAAAGAGCTGAAAAGGGTTCGTCGACACACCTACACACCTACACACAGTGAGATTTTGATCTGAATCCAAACTCCCATTATCATCATGCCGAAGGAACACGCAAACTGGTCTCCATACGATAACAATGGAGGAACTTGTGTAGCGATTGCTGGTGCAGATTACTGTGTGATTGCGGCGGATACTCGGATGTCCACCGGTTAC...

CDS

Download CDS FASTA

672 bp · TkA07G438120|TK1151|CDS

ATGCCGAAGGAACACGCAAACTGGTCTCCATACGATAACAATGGAGGAACTTGTGTAGCGATTGCTGGTGCAGATTACTGTGTGATTGCGGCGGATACTCGGATGTCCACCGGTTACAGTATTCTCACCCGAGAGTACTCCAAAATCTGTAAATTAGCAGACAAAAGTTTCATGGCTTCTTCAGGATTTCAGGCTGATGTAAAAGCACTTCAAAAGGTTTTGTCTTCCAGACACCTGATTTATCAACACCAACACAACAA...

Protein

Download Protein FASTA

223 aa · TkA07G438120|TK1151|PROTEIN

MPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTREYSKICKLADKSFMASSGFQADVKALQKVLSSRHLIYQHQHNKQMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSEGKGCVFTYDAVGSYERVGYSAQGSGATLITPFLDNQLKSPSPLLLPAKDAVTPLSEAEAIDLVKTCFSSATERDIYTGDSVEIIILNAKGVRHESEPLRKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G438120`
TK1151 ID	TkA07G438120
OH-1004 ID	LXL04_030876
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G438120

Location Chr07:110925227-110929737 (-)

Description Similar to PBF1: Proteasome subunit beta type-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60820`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0505600`	Non-catalytic component of the proteasome, a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030876 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005839 proteasome core complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G60820

ddi:DDB_G0272969

dosa:Os09g0505600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.777

Rank 1 · TkA07G438120 · TK1151

Nucleus0.659

Rank 2 · TkA07G438120 · TK1151

Mitochondrion0.053

Rank 3 · TkA07G438120 · TK1151

Peroxisome0.037

Rank 4 · TkA07G438120 · TK1151

Cell membrane0.020

Rank 5 · TkA07G438120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00227Proteasome13-207 aa

PF27977CEP7032-103 aa

PF05043Mga41-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G438120	`PF00227`	Proteasome	13	207	5.4e-38	131.2
TkA07G438120	`PF27977`	CEP70	32	103	0.068	12.5
TkA07G438120	`PF05043`	Mga	41	80	0.12	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42742`	Arabidopsis thaliana	sp\|P42742\|PSB1_ARATH Proteasome subunit beta type-1	84.300%	Swiss-Prot	High
`O64464`	Oryza sativa subsp. japonica	sp\|O64464\|PSB1_ORYSJ Proteasome subunit beta type-1	78.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card