TkA07G435190 | RubberDandelionOmics

Gene overview

TkA07G435190

Reference: TK1151 Chr: Chr07 Coordinates: 110153632-110155412 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

889 bp · TkA07G435190|TK1151|cDNA

TTTTAGTTAGCCCTCTTTCTAGTAATAAAACATGGGATCATCGTCTCCGCCGTCTAGCCTACACCATCAGTAATCGCAGCAGCAGCTCCGTCTCAACTGGTGTTTTACATCTTGCTATTCTGCGTAAGCATCATGACAAAGCTAAGGAAGCTCAATCGTCCTACTGGTCATAGAATCTCCATGCTCAGGACCATGGTCTCACAACTGGTCAAACATGAACGTATAGAAACCACTGTTGCCAAGGCAAAAGAAGTCCGCCG...

CDS

Download CDS FASTA

483 bp · TkA07G435190|TK1151|CDS

ATGACAAAGCTAAGGAAGCTCAATCGTCCTACTGGTCATAGAATCTCCATGCTCAGGACCATGGTCTCACAACTGGTCAAACATGAACGTATAGAAACCACTGTTGCCAAGGCAAAAGAAGTCCGCCGTTTAGCTGATAACATGGTACAGCTAGGAAAAGAGGGTACCCTTTGTGCTGCCAGGCGTGCTGCTGCTTTTGTGAGAGGAGATGATGTCATTCACAAACTATTTACAGAACTGGCTTACAGATACAAAGATAG...

Protein

Download Protein FASTA

160 aa · TkA07G435190|TK1151|PROTEIN

MTKLRKLNRPTGHRISMLRTMVSQLVKHERIETTVAKAKEVRRLADNMVQLGKEGTLCAARRAAAFVRGDDVIHKLFTELAYRYKDRAGGYTRVLRTRIRVGDAAPMAYIEFIDRENELRQSKPPAPQPPQRPAVDPWTRSQLSRSFASPKEVKTSESED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G435190`
TK1151 ID	TkA07G435190
OH-1004 ID	LXL04_030834
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G435190`
Location	Chr07:110153632-110155412 (+)
Description	Similar to rplQ: 50S ribosomal protein L17 (Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030834` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0022625 cytosolic large ribosomal subunit Cellular Component GO:0003735 structural constituent of ribosome Molecular Function
KEGG gene cross-reference	glo:Glov_1374 gsu:GSU2830 mgm:Mmc1_0873 ppd:Ppro_0707 sfu:Sfum_1583 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.407

Rank 1 · TkA07G435190 · TK1151

Mitochondrion0.365

Rank 2 · TkA07G435190 · TK1151

Cytoplasm0.113

Rank 3 · TkA07G435190 · TK1151

Nucleus0.044

Rank 4 · TkA07G435190 · TK1151

Extracellular0.006

Rank 5 · TkA07G435190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01196Ribosomal_L1717-113 aa

PF10834DUF256032-46 aa

PF01583APS_kinase55-117 aa

PF10834DUF256058-80 aa

PF13986DUF422474-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G435190	`PF01196`	Ribosomal_L17	17	113	1.5e-36	125.9
TkA07G435190	`PF10834`	DUF2560	32	46	0.21	12.6
TkA07G435190	`PF01583`	APS_kinase	55	117	0.19	12.5
TkA07G435190	`PF10834`	DUF2560	58	80	0.21	12.6
TkA07G435190	`PF13986`	DUF4224	74	99	0.0012	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card