TkA07G434950 | RubberDandelionOmics

Gene overview

TkA07G434950

Reference: TK1151 Chr: Chr07 Coordinates: 110069837-110072177 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · TkA07G434950|TK1151|cDNA

ATGGCCATTTTCTCCAATATTCAACATCCAATGCTTTTTACTTTTGGCATTTTAGGAAACATCGTTTCGCTCATGGTGTATCTTGCTCCTGCGCCAACTTTTTACACAATCGTAAAGAGAAAATCAACACAAGGGTTTCTATCAATACCCTATGTTGTCGCTCTCTTTAGCTCGATGATTTGGATATATTATGCGACACTTAAAACCGATGCAACCCTTCTCATCACAATCAACGCCGTTGGTTGTGTCATCGAGACCTT...

CDS

Download CDS FASTA

993 bp · TkA07G434950|TK1151|CDS

ATGGCCATTTTCTCCAATATTCAACATCCAATGCTTTTTACTTTTGGCATTTTAGGAAACATCGTTTCGCTCATGGTGTATCTTGCTCCTGCGCCAACTTTTTACACAATCGTAAAGAGAAAATCAACACAAGGGTTTCTATCAATACCCTATGTTGTCGCTCTCTTTAGCTCGATGATTTGGATATATTATGCGACACTTAAAACCGATGCAACCCTTCTCATCACAATCAACGCCGTTGGTTGTGTCATCGAGACCTT...

Protein

Download Protein FASTA

330 aa · TkA07G434950|TK1151|PROTEIN

MAIFSNIQHPMLFTFGILGNIVSLMVYLAPAPTFYTIVKRKSTQGFLSIPYVVALFSSMIWIYYATLKTDATLLITINAVGCVIETLYTAIFIAYAPKKIKIQTTKLVVLLNFVSFWVIALSTHYLAEGPVRVEILGWICMVISVSVYAAPLSIMKKVIQTKSVEFMPFGLSFFLALSAVMWFFYGLLQKDLYIATPNIIGFFLGIIQMVLYMVFKNYNKKTIDLEKNSLPSKTLEVCDMPKHKANNTKDETATAKCCKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G434950`
TK1151 ID	TkA07G434950
OH-1004 ID	LXL04_009338
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.500
Protein coverage (%)	TK1151 79.697 / OH-1004 82.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G434950

Location Chr07:110069837-110072177 (-)

Description Similar to SWEET14: Bidirectional sugar transporter SWEET14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BKP4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os11g0508600`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	Sugar transporters for intercellular exchange and nutrition of pathogens.2010 · DOI: 10.1038/nature09606 Five phylogenetically close rice SWEET genes confer TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.2013 · DOI: 10.1111/nph.12411
`UniProt: A2X5B4`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os02g0513100`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os12g0476200`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009338 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0009555 pollen development Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0015770 sucrose transport Biological Process

GO:0048571 long-day photoperiodism Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008515 sucrose transmembrane transporter activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G50790

dosa:Os11g0508600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.782

Rank 1 · TkA07G434950 · TK1151

Endoplasmic reticulum0.103

Rank 2 · TkA07G434950 · TK1151

Cytoplasm0.091

Rank 3 · TkA07G434950 · TK1151

Lysosome / Vacuole0.058

Rank 4 · TkA07G434950 · TK1151

Golgi apparatus0.040

Rank 5 · TkA07G434950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv14-99 aa

PF22258DUF694934-48 aa

PF29773YfkS51-67 aa

PF03083MtN3_slv135-218 aa

PF22258DUF6949140-186 aa

PF29773YfkS175-185 aa

PF29773YfkS203-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G434950	`PF03083`	MtN3_slv	14	99	7.7e-54	180.4
TkA07G434950	`PF22258`	DUF6949	34	48	0.032	15.2
TkA07G434950	`PF29773`	YfkS	51	67	3.3	8.1
TkA07G434950	`PF03083`	MtN3_slv	135	218	7.7e-54	180.4
TkA07G434950	`PF22258`	DUF6949	140	186	0.032	15.2
TkA07G434950	`PF29773`	YfkS	175	185	3.3	8.1
TkA07G434950	`PF29773`	YfkS	203	221	3.3	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B8BKP4`	Oryza sativa subsp. indica	sp\|B8BKP4\|SWT14_ORYSI Bidirectional sugar transporter SWEET14	56.000%	Swiss-Prot	Medium
`Q2R3P9`	Oryza sativa subsp. japonica	sp\|Q2R3P9\|SWT14_ORYSJ Bidirectional sugar transporter SWEET14	56.000%	Swiss-Prot	Medium
`A2X5B4`	Oryza sativa subsp. indica	sp\|A2X5B4\|SWT15_ORYSI Bidirectional sugar transporter SWEET15	60.100%	Swiss-Prot	Medium
`Q6K602`	Oryza sativa subsp. japonica	sp\|Q6K602\|SWT15_ORYSJ Bidirectional sugar transporter SWEET15	60.100%	Swiss-Prot	Medium
`Q2QR07`	Oryza sativa subsp. japonica	sp\|Q2QR07\|SWT13_ORYSJ Bidirectional sugar transporter SWEET13	61.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card