TkA07G433960 | RubberDandelionOmics

Gene overview

TkA07G433960

Reference: TK1151 Chr: Chr07 Coordinates: 109800167-109805616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2785 bp · TkA07G433960|TK1151|cDNA

CGAAAACATGGGCCTCCTTGTAGTTTTATAAAATTTATCGAAACAAATGTTTTGTACCAATCACTTTCCCATCATATATTTGTTTCATCTAACACCGTTACACCGCCGTTTAGCTACCCCTGAACGACTGAACGTTACAGAGTTTACTCCGGTTCTTCACCGGCGGTCGACGGCACCGCTATTTCATTGCTCCTACCAAATGATCATCGCCCCAACCACAACCGGCAGCGTTTATATACTTCTCTTCTCCGGTTTTCTCA...

CDS

Download CDS FASTA

2268 bp · TkA07G433960|TK1151|CDS

ATGCTAAAATTCACCTCCATGGGCGAAACTAAAGTTAAGCAAGAAATCCTAGAACCACTCCGTACCGACAATGGTAATTTTACTAGAAGGAAGAACGTTTCGGATGCTCCGTTGATTGATCTCGATAGTTCCGACGATGATTCTTCTACTTCTGGTAATGGAGTTAGTAACGGCAAGAGGCCTAGGGTTTCAGGCAATCATGGTGGTGATAAGAGGAAAAAAACTGGTGAGGGTGTCGTTCTGCCTGCTGGTTTCCTTGA...

Protein

Download Protein FASTA

755 aa · TkA07G433960|TK1151|PROTEIN

MLKFTSMGETKVKQEILEPLRTDNGNFTRRKNVSDAPLIDLDSSDDDSSTSGNGVSNGKRPRVSGNHGGDKRKKTGEGVVLPAGFLDPLPPKDVASRAANGAVVAAQSCKQFWKAGDFEQGAGDKWEASSGGMDHVRVHPRFLHSNATSHKWVLGAFAELLDNSLDEACNGATYINIDMLTNKKDGNRMLLIEDNGGGMDPDKMRHCMSLGYSLKSKVKDTIGQYGNGFKTSTMRLGADVIVFSRCSPKDGTRSTQTIGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G433960`
TK1151 ID	TkA07G433960
OH-1004 ID	LXL04_030822
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G433960

Location Chr07:109800167-109805616 (+)

Description Similar to MORC4: Protein MICRORCHIDIA 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50780`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At4g24970`	Exhibits ATPase activity.	Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998
`At5g13130`	Exhibits ATPase activity.	No verified direct reference in this release
`At4g36280`	Mediator of defense signaling triggered by distinct classes of R proteins.	Endosome-associated CRT1 functions early in resistance gene-mediated defense signaling in Arabidopsis and tobacco.2010 · DOI: 10.1105/tpc.109.071662 CRT1 is a nuclear-translocated MORC endonuclease that participates in multiple levels of plant immunity.2012 · DOI: 10.1038/ncomms2279 Transcriptional gene silencing by Arabidopsis microrchidia homologues involves the formation of heteromers.2014 · DOI: 10.1073/pnas.1406611111
`At1g19100`	Involved in RNA-directed DNA methylation (RdDM) as a component of the RdDM machinery and required for gene silencing.	MORC family ATPases required for heterochromatin condensation and gene silencing.2012 · DOI: 10.1126/science.1221472 Involvement of a GHKL ATPase in RNA-directed DNA methylation in Arabidopsis thaliana.2012 · DOI: 10.1016/j.cub.2012.03.061 The stochastic silencing phenotype of Arabidopsis morc6 mutants reveals a role in efficient RNA-directed DNA methylation.2013 · DOI: 10.1111/tpj.12246 Arabidopsis AtMORC4 and AtMORC7 Form Nuclear Bodies and Repress a Large Number of Protein-Coding Genes.2016 · DOI: 10.1371/journal.pgen.1005998 Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1006026

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030822 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1902290 positive regulation of defense response to oomycetes Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G19100

ath:AT4G24970

ath:AT5G13130

ath:AT5G50780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA07G433960 · TK1151

Cytoplasm0.124

Rank 2 · TkA07G433960 · TK1151

Cell membrane0.024

Rank 3 · TkA07G433960 · TK1151

Mitochondrion0.022

Rank 4 · TkA07G433960 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA07G433960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518HATPase_c51-79 aa

PF13589HATPase_c_3155-258 aa

PF02518HATPase_c156-253 aa

PF17942Morc6_S5385-529 aa

PF26729TMA17_helical620-660 aa

PF06785UPF0242642-745 aa

PF15905HMMR_N647-735 aa

PF14931IFT20666-735 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G433960	`PF02518`	HATPase_c	51	79	2.7e-06	28.5
TkA07G433960	`PF13589`	HATPase_c_3	155	258	2.2e-17	64.1
TkA07G433960	`PF02518`	HATPase_c	156	253	2.7e-06	28.5
TkA07G433960	`PF17942`	Morc6_S5	385	529	1.8e-59	200.5
TkA07G433960	`PF26729`	TMA17_helical	620	660	5.0	8.3
TkA07G433960	`PF06785`	UPF0242	642	745	5.5	7.7
TkA07G433960	`PF15905`	HMMR_N	647	735	4.7	7.3
TkA07G433960	`PF14931`	IFT20	666	735	2.3	9.2
TkA07G433960	`PF29874`	Wac	676	745	0.22	12.2
TkA07G433960	`PF26729`	TMA17_helical	681	745	5.0	8.3
TkA07G433960	`PF15905`	HMMR_N	704	746	4.7	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAF2`	Arabidopsis thaliana	sp\|F4KAF2\|MORC4_ARATH Protein MICRORCHIDIA 4	57.800%	Swiss-Prot	High
`F4JRS4`	Arabidopsis thaliana	sp\|F4JRS4\|MORC7_ARATH Protein MICRORCHIDIA 7	65.000%	Swiss-Prot	High
`F4K2G3`	Arabidopsis thaliana	sp\|F4K2G3\|MORC5_ARATH Protein MICRORCHIDIA 5	60.600%	Swiss-Prot	Medium
`Q5FV35`	Arabidopsis thaliana	sp\|Q5FV35\|MORC2_ARATH Protein MICRORCHIDIA 2	49.700%	Swiss-Prot	Medium
`Q56Y74`	Arabidopsis thaliana	sp\|Q56Y74\|MORC6_ARATH Protein MICRORCHIDIA 6	49.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card