TkA07G433420 | RubberDandelionOmics

Gene overview

TkA07G433420

Reference: TK1151 Chr: Chr07 Coordinates: 109658362-109660712 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · TkA07G433420|TK1151|cDNA

TAAAAATCCACGTCAGGCAGGTTTATGATGGCAGAATTGAGTGCTATTCTCGCTAGATCTGATGGTCCTGCTCATCATCCAACTCAATCACACACTCCCTTTTCACCTCGTTTAAATCACACACTAGTGTCCCTTACTGTGTGTATTTTCGTGCCTTCTATCATCTCGATACATAGCCCCTACCCCTTGTTTCAATCTTGTGTTCATCCTGTCATCAATGGGAGAGGAGGTACAGAAGCCGGAGGAGGAGAAGAAAGCTG...

CDS

Download CDS FASTA

927 bp · TkA07G433420|TK1151|CDS

ATGGGAGAGGAGGTACAGAAGCCGGAGGAGGAGAAGAAAGCTGAGGGAGAAGCGAAACCGGTGGCCGGAGATGAGAAAAAGGGAGAGGATTTGAAAGAACCGGCGCCGCCTCCGCCGCCGGAAGAGGTGGTTTTGAGAGTGTTCATGCACTGTGAAGGCTGCGCTAGAAAAGTCCGGCGATGTCTTAGAGGATTCGACGGTGTTGAAGAAGTTGTTACGGATTGTAAGACTCATAAGGTTGTAGTAAAGGGACAAAAAGT...

Protein

Download Protein FASTA

308 aa · TkA07G433420|TK1151|PROTEIN

MGEEVQKPEEEKKAEGEAKPVAGDEKKGEDLKEPAPPPPPEEVVLRVFMHCEGCARKVRRCLRGFDGVEEVVTDCKTHKVVVKGQKVDAVKVLERVQKKSHRKVELLSPTPTPPAEEPKKPEQEEAPKSEEKKDEPAAVISVVLKVHMHCEACAQEIRKRILRMKGVESAVPDLKSSQVEVKGTFPAAELVDYVHKRTGKHAVIIKQDPEPKKEEDNNGKDENKDGESDGGGGEKKEEKKADGVGDKQETTPKPEDAAVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G433420`
TK1151 ID	TkA07G433420
OH-1004 ID	LXL04_009368
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.800
Protein coverage (%)	TK1151 86.688 / OH-1004 69.816 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G433420

Location Chr07:109658362-109660712 (+)

Description Similar to HIPP07: Heavy metal-associated isoprenylated plant protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63530`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g02960`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g24580`	Heavy-metal-binding protein.	No verified direct reference in this release
`At2g36950`	Heavy-metal-binding protein (By similarity).	No verified direct reference in this release
`At5g60800`	Heavy-metal-binding protein.	The zinc-binding nuclear protein HIPP3 acts as an upstream regulator of the salicylate-dependent plant immunity pathway and of flowering time in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13419

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0046914 transition metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G36950

ath:AT3G02960

ath:AT5G03380

ath:AT5G24580

ath:AT5G63530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · TkA07G433420 · TK1151

Cell membrane0.430

Rank 2 · TkA07G433420 · TK1151

Nucleus0.291

Rank 3 · TkA07G433420 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA07G433420 · TK1151

Golgi apparatus0.030

Rank 5 · TkA07G433420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19803DUF628643-114 aa

PF00403HMA45-99 aa

PF21326KDM6_GATAL47-66 aa

PF15643Tox-PL-249-63 aa

PF10656DUF248362-96 aa

PF14639YqgF66-103 aa

PF04147Nop1469-134 aa

PF00403HMA144-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G433420	`PF19803`	DUF6286	43	114	4.9e-06	27.7
TkA07G433420	`PF00403`	HMA	45	99	2.5e-25	89.4
TkA07G433420	`PF21326`	KDM6_GATAL	47	66	0.01	16.4
TkA07G433420	`PF15643`	Tox-PL-2	49	63	0.022	15.7
TkA07G433420	`PF10656`	DUF2483	62	96	0.06	14.4
TkA07G433420	`PF14639`	YqgF	66	103	0.053	14.0
TkA07G433420	`PF04147`	Nop14	69	134	0.93	8.4
TkA07G433420	`PF00403`	HMA	144	201	2.5e-25	89.4
TkA07G433420	`PF19803`	DUF6286	144	189	4.9e-06	27.7
TkA07G433420	`PF21326`	KDM6_GATAL	145	159	0.01	16.4
TkA07G433420	`PF15643`	Tox-PL-2	147	192	0.022	15.7
TkA07G433420	`PF04147`	Nop14	158	246	0.93	8.4
TkA07G433420	`PF10656`	DUF2483	190	207	0.06	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5D3`	Arabidopsis thaliana	sp\|Q9C5D3\|HIP7_ARATH Heavy metal-associated isoprenylated plant protein 7	54.900%	Swiss-Prot	High
`Q9M8T7`	Arabidopsis thaliana	sp\|Q9M8T7\|HIP8_ARATH Heavy metal-associated isoprenylated plant protein 8	41.900%	Swiss-Prot	Medium
`Q9FLU5`	Arabidopsis thaliana	sp\|Q9FLU5\|HIP9_ARATH Heavy metal-associated isoprenylated plant protein 9	38.200%	Swiss-Prot	Medium
`Q9SJL2`	Arabidopsis thaliana	sp\|Q9SJL2\|HIP5_ARATH Heavy metal-associated isoprenylated plant protein 5	35.800%	Swiss-Prot	Medium
`Q9FJH5`	Arabidopsis thaliana	sp\|Q9FJH5\|HIP3_ARATH Heavy metal-associated isoprenylated plant protein 3	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card