TkA07G432920 | RubberDandelionOmics

Gene overview

TkA07G432920

Reference: TK1151 Chr: Chr07 Coordinates: 109534542-109537670 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2248 bp · TkA07G432920|TK1151|cDNA

CACACCTGCTGGTTTTTCTTTCATCAATACCTCTACAATAAAAACCATAAACATTCATATTTTCAGGTTGTTAGCATGAATTCGTTTAGGGATTTGTGGAGGATTTAGAAGACTAAATTGTTCGTTTATGAAAATCATTGATCAGGAACAGTCAACAAACGCCACATAAAATCGGGTTTTCGGAGGAGATTTCCAGTGGCGCCTCCTCCGTTGGTTGAGTATTTCAGGGCTTGCTCAATCAGAGGAAGGCCCTCCACTCT...

CDS

Download CDS FASTA

1290 bp · TkA07G432920|TK1151|CDS

ATGCACTTTGAGTACTTGAAACTTTATCTAAACCAAAAAATTATTTGCACTAATTGCCACCACCCCTTTTGGGCTTTACCATTATCTGGCCCAAGCCCAGTATGGGCCCATCAAAAGCCCAATCCACAACATGTGAACCTTGGAGGACAAGTTAAGAGGCAACATCATGAATCGAAAGCGAATAGCAGCTCTGTTTTTGCGAAAAAGAGACGTGTGGTTGACCAGTCAAACTTCGAAAGTCAAAAAGTCAAAGTCAAACC...

Protein

Download Protein FASTA

429 aa · TkA07G432920|TK1151|PROTEIN

MHFEYLKLYLNQKIICTNCHHPFWALPLSGPSPVWAHQKPNPQHVNLGGQVKRQHHESKANSSSVFAKKRRVVDQSNFESQKVKVKPPNSSVNTRELSNSEIRTMLVTKSKKEIQKKLNEWNIEKELQKEVTSKKEQKETISNEGKTVKSQSEEDTIDDVDNNDDVDTDTSATLMTVPDPDFHDFDMDRTERAFSENEIWAAYDEDDGMPRYYAMIHTVISKKPFKLQISWLNSKSNSELAPINWVTSGFPKTTGEFRLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G432920`
TK1151 ID	TkA07G432920
OH-1004 ID	LXL04_021600
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.300
Protein coverage (%)	TK1151 98.135 / OH-1004 65.297 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G432920`
Location	Chr07:109534542-109537670 (-)
Description	Similar to ATJ49: Chaperone protein dnaJ 49
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021600` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0036503 ERAD pathway Biological Process GO:0065003 protein-containing complex assembly Biological Process GO:0071218 cellular response to misfolded protein Biological Process GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0030544 Hsp70 protein binding Molecular Function
KEGG gene cross-reference	ath:AT5G49060 mmu:56709 mmu:70604 xla:380336 xtr:549342 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · TkA07G432920 · TK1151

Cytoplasm0.087

Rank 2 · TkA07G432920 · TK1151

Cell membrane0.024

Rank 3 · TkA07G432920 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA07G432920 · TK1151

Mitochondrion0.009

Rank 5 · TkA07G432920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23551Zn_ribbon_201-25 aa

PF31087LysG91-160 aa

PF14000Packaging_FI95-174 aa

PF11926DUF3444173-378 aa

PF31087LysG404-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G432920	`PF23551`	Zn_ribbon_20	1	25	1e-05	26.2
TkA07G432920	`PF31087`	LysG	91	160	0.32	11.7
TkA07G432920	`PF14000`	Packaging_FI	95	174	0.27	12.3
TkA07G432920	`PF11926`	DUF3444	173	378	5e-71	239.3
TkA07G432920	`PF31087`	LysG	404	419	0.32	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card