TkA07G432260 | RubberDandelionOmics

Gene overview

TkA07G432260

Reference: TK1151 Chr: Chr07 Coordinates: 109377276-109381159 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1370 bp · TkA07G432260|TK1151|cDNA

GTTAGTCTCTGTGATCACTTTATACGAAGAAAGAGAGAGTTTCAGAGATAGAAGATGGTGATGGAAGATGAAAGTCCGAGGAGTCCAGAGGCGAAGCTAGGGATGGAGCTGGAGGAACTGTGGGACGTACAGGAGGCGCAACTTTCTCCGACGGAGAAGCTCAACGCTTGTTTCGAGAGTATTCCTGTTTCGGAATTCCCTCATGCTTCGCCTTCACAAGTAATTGAGATAAAATCAGATGCAAGTCTGGGCGAAGCTGT...

CDS

Download CDS FASTA

1257 bp · TkA07G432260|TK1151|CDS

ATGGTGATGGAAGATGAAAGTCCGAGGAGTCCAGAGGCGAAGCTAGGGATGGAGCTGGAGGAACTGTGGGACGTACAGGAGGCGCAACTTTCTCCGACGGAGAAGCTCAACGCTTGTTTCGAGAGTATTCCTGTTTCGGAATTCCCTCATGCTTCGCCTTCACAAGTAATTGAGATAAAATCAGATGCAAGTCTGGGCGAAGCTGTCAGATTGCTAGCCCAAAACAAAATTCTCAGTGCACCTGTTGTAGACGTTGATGC...

Protein

Download Protein FASTA

418 aa · TkA07G432260|TK1151|PROTEIN

MVMEDESPRSPEAKLGMELEELWDVQEAQLSPTEKLNACFESIPVSEFPHASPSQVIEIKSDASLGEAVRLLAQNKILSAPVVDVDAPEDASWIDRYLGIVEFAGIVVWILHQSEKNDGYDVFPSALDSYLRPAVVAAAGGMSSPRYRSSQPDSPKTAGNFFELLTSSDFYKNTKVKDISGSFRWAPFLALQTSNSFLTMLLLLSKYRMKSVPVIDPGDQNIHNIITQSAVIHMLEECADLQWFKSWGSKKLCELGLPLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G432260`
TK1151 ID	TkA07G432260
OH-1004 ID	LXL04_030802
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G432260

Location Chr07:109377276-109381159 (+)

Description Similar to KING1: SNF1-related protein kinase regulatory subunit gamma-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48530`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release
`At1g69800`	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	No verified direct reference in this release
`At1g80090`	Plays redundant role with PV42a in regulating male gametogenesis and pollen tube guidance.	AtPV42a and AtPV42b redundantly regulate reproductive development in Arabidopsis thaliana.2011 · DOI: 10.1371/journal.pone.0019033

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030802 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005977 glycogen metabolic process Biological Process

GO:0006110 regulation of glycolytic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0014873 response to muscle activity involved in regulation of muscle adaptation Biological Process

GO:0019217 regulation of fatty acid metabolic process Biological Process

GO:0031669 cellular response to nutrient levels Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0042149 cellular response to glucose starvation Biological Process

GO:0045719 negative regulation of glycogen biosynthetic process Biological Process

GO:0045722 positive regulation of gluconeogenesis Biological Process

GO:0050790 regulation of catalytic activity Biological Process

KEGG gene cross-reference

ath:AT1G69800

ath:AT3G48530

hsa:53632

mmu:108099

mmu:241113

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.430

Rank 1 · TkA07G432260 · TK1151

Nucleus0.346

Rank 2 · TkA07G432260 · TK1151

Cell membrane0.170

Rank 3 · TkA07G432260 · TK1151

Lysosome / Vacuole0.156

Rank 4 · TkA07G432260 · TK1151

Golgi apparatus0.093

Rank 5 · TkA07G432260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00571CBS55-86 aa

PF00571CBS191-235 aa

PF27371GRAD_C229-246 aa

PF00571CBS262-306 aa

PF01637ATPase_2330-377 aa

PF27371GRAD_C331-375 aa

PF00571CBS348-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G432260	`PF00571`	CBS	55	86	2.4e-32	111.7
TkA07G432260	`PF00571`	CBS	191	235	2.4e-32	111.7
TkA07G432260	`PF27371`	GRAD_C	229	246	0.068	13.4
TkA07G432260	`PF00571`	CBS	262	306	2.4e-32	111.7
TkA07G432260	`PF01637`	ATPase_2	330	377	0.21	12.1
TkA07G432260	`PF27371`	GRAD_C	331	375	0.068	13.4
TkA07G432260	`PF00571`	CBS	348	395	2.4e-32	111.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBB2`	Arabidopsis thaliana	sp\|Q8LBB2\|KING1_ARATH SNF1-related protein kinase regulatory subunit gamma-1	65.200%	Swiss-Prot	High
`Q9CAR3`	Arabidopsis thaliana	sp\|Q9CAR3\|KINGL_ARATH SNF1-related protein kinase regulatory subunit gamma-1-like	38.100%	Swiss-Prot	Medium
`Q8GXI9`	Arabidopsis thaliana	sp\|Q8GXI9\|PV42B_ARATH SNF1-related protein kinase regulatory subunit gamma-like PV42b	20.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card