TkA07G431380 | RubberDandelionOmics

Gene overview

TkA07G431380

Reference: TK1151 Chr: Chr07 Coordinates: 109131342-109134723 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA07G431380|TK1151|cDNA

GGAAAGATGGACATGTGTGGTGATCCGGCGTTTGTCCGATCGGCATGTGAAGCTAGCTTGAAGAGACTTGATATTGATTGTATCGATCTCTACTATATCCTTAGAATTGATATCTGTGTCCCAATCGAAGTCACGGTTCGCCTCTTTTCACTTTTTTTGTTTTCTAATTTGGGTAAAACCATTTTCCATCGCTGCCATAAACCTAAAAACCAGTGGTTTGAGAAATTTCTACTTAATTACTTCCTAGTTTTTCTCTTCTT...

CDS

Download CDS FASTA

303 bp · TkA07G431380|TK1151|CDS

ATGGACATGTGTGGTGATCCGGCGTTTGTCCGATCGGCATGTGAAGCTAGCTTGAAGAGACTTGATATTGATTGTATCGATCTCTACTATATCCTTAGAATTGATATCTGTGTCCCAATCGAAGTCACGGTTCGCCTCTTTTCACTTTTTTTGTTTTCTAATTTGGGTAAAACCATTTTCCATCGCTGCCATAAACCTAAAAACCAGTGGTTTGAGAAATTTCTACTTAATTACTTCCTAGTTTTTCTCTTCTTGCAAAT...

Protein

Download Protein FASTA

100 aa · TkA07G431380|TK1151|PROTEIN

MDMCGDPAFVRSACEASLKRLDIDCIDLYYILRIDICVPIEVTVRLFSLFLFSNLGKTIFHRCHKPKNQWFEKFLLNYFLVFLFLQIQSCMVATITFLHA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G431380`
TK1151 ID	TkA07G431380
OH-1004 ID	LXL04_004128
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.600
Protein coverage (%)	TK1151 44.000 / OH-1004 6.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G431380

Location Chr07:109131342-109134723 (+)

Description Similar to Os04g0338000: Probable aldo-keto reductase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60690`	Probable aldo-keto reductase 3.	No verified direct reference in this release
`At1g60680`	Probable aldo-keto reductase 2.	No verified direct reference in this release
`At1g10810`	Probable aldo-keto reductase 1.	No verified direct reference in this release
`At1g60710`	Probable aldo-keto reductase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60690

dosa:Os04g0338000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.476

Rank 1 · TkA07G431380 · TK1151

Nucleus0.273

Rank 2 · TkA07G431380 · TK1151

Mitochondrion0.169

Rank 3 · TkA07G431380 · TK1151

Endoplasmic reticulum0.092

Rank 4 · TkA07G431380 · TK1151

Peroxisome0.070

Rank 5 · TkA07G431380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red5-45 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G431380	`PF00248`	Aldo_ket_red	5	45	0.00022	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22707`	Arabidopsis thaliana	sp\|O22707\|ALKR3_ARATH Probable aldo-keto reductase 3	75.000%	Swiss-Prot	Low
`Q84M96`	Arabidopsis thaliana	sp\|Q84M96\|ALKR2_ARATH Probable aldo-keto reductase 2	75.600%	Swiss-Prot	Low
`Q9C5B9`	Arabidopsis thaliana	sp\|Q9C5B9\|ALKR1_ARATH Probable aldo-keto reductase 1	72.500%	Swiss-Prot	Low
`Q93ZN2`	Arabidopsis thaliana	sp\|Q93ZN2\|ALKR4_ARATH Probable aldo-keto reductase 4	72.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card