TkA07G429600 | RubberDandelionOmics

Gene overview

TkA07G429600

Reference: TK1151 Chr: Chr07 Coordinates: 108742467-108744806 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1249 bp · TkA07G429600|TK1151|cDNA

AAAAAGATCTACGCCTTCGGAGACTCTTTCACCGACACCGGAAACACCAATTCCGCCACTGGCCCCCAGGGCTTCACTCACGTCTCCAACCTCCCTTACGGCCGGACATTTTTCCACCGCCCAACCAACCGCTACTCCGACGGCCGTCTGGTAATCGACTTCGTGGCGGAATCACTCTCGTTACCCTACCTACCACCTTATCTCAACCGCAATGCAGACACCTCCGCCGGTATCAACTACGCCGTCGCAGGATCCACCGC...

CDS

Download CDS FASTA

1032 bp · TkA07G429600|TK1151|CDS

AAAAAGATCTACGCCTTCGGAGACTCTTTCACCGACACCGGAAACACCAATTCCGCCACTGGCCCCCAGGGCTTCACTCACGTCTCCAACCTCCCTTACGGCCGGACATTTTTCCACCGCCCAACCAACCGCTACTCCGACGGCCGTCTGGTAATCGACTTCGTGGCGGAATCACTCTCGTTACCCTACCTACCACCTTATCTCAACCGCAATGCAGACACCTCCGCCGGTATCAACTACGCCGTCGCAGGATCCACCGC...

Protein

Download Protein FASTA

343 aa · TkA07G429600|TK1151|PROTEIN

KKIYAFGDSFTDTGNTNSATGPQGFTHVSNLPYGRTFFHRPTNRYSDGRLVIDFVAESLSLPYLPPYLNRNADTSAGINYAVAGSTAIRHAFFVKNNLTLNITPQSLQTQLNWFNKTLKGKKCKSAKSTPEECAAVFRDALIWVGEIGVNDYAYSVGSTVSVKTIQRRAIRSVTGFIEALLNKGAKYIVVQGLPTTGCLTLTLYLASDSDRDDIGCAATANIQSHIHNTNLQTNIQNLRTKYPKAIIVYADYWSAYRSIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G429600`
TK1151 ID	TkA07G429600
OH-1004 ID	LXL04_030767
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 88.860 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G429600

Location Chr07:108742467-108744806 (+)

Description Similar to At3g48460: GDSL esterase/lipase At3g48460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48460`	GDSL esterase/lipase At3g48460.	No verified direct reference in this release
`At1g28600`	GDSL esterase/lipase At1g28600.	No verified direct reference in this release
`At1g28650`	GDSL esterase/lipase At1g28650.	No verified direct reference in this release
`At1g28590`	GDSL esterase/lipase At1g28590.	No verified direct reference in this release
`At1g28580`	GDSL esterase/lipase At1g28580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030767 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005976 polysaccharide metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008126 acetylesterase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0046555 acetylxylan esterase activity Molecular Function

KEGG gene cross-reference

ath:AT1G28580

ath:AT1G28590

ath:AT1G28600

ath:AT1G28650

ath:AT3G48460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.690

Rank 1 · TkA07G429600 · TK1151

Cytoplasm0.109

Rank 2 · TkA07G429600 · TK1151

Endoplasmic reticulum0.066

Rank 3 · TkA07G429600 · TK1151

Lysosome / Vacuole0.055

Rank 4 · TkA07G429600 · TK1151

Cell membrane0.033

Rank 5 · TkA07G429600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL3-324 aa

PF13472Lipase_GDSL_2146-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G429600	`PF00657`	Lipase_GDSL	3	324	5e-27	96.1
TkA07G429600	`PF13472`	Lipase_GDSL_2	146	319	6.3e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STM6`	Arabidopsis thaliana	sp\|Q9STM6\|GDL57_ARATH GDSL esterase/lipase At3g48460	58.600%	Swiss-Prot	High
`Q94F40`	Arabidopsis thaliana	sp\|Q94F40\|GDL9_ARATH GDSL esterase/lipase At1g28600	40.500%	Swiss-Prot	Medium
`Q3E7I6`	Arabidopsis thaliana	sp\|Q3E7I6\|GDL11_ARATH GDSL esterase/lipase At1g28650	39.500%	Swiss-Prot	Medium
`Q8RXT9`	Arabidopsis thaliana	sp\|Q8RXT9\|GDL8_ARATH GDSL esterase/lipase At1g28590	39.400%	Swiss-Prot	Medium
`Q9FXJ2`	Arabidopsis thaliana	sp\|Q9FXJ2\|GDL7_ARATH GDSL esterase/lipase At1g28580	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card