TkA07G429020 | RubberDandelionOmics

Gene overview

TkA07G429020

Reference: TK1151 Chr: Chr07 Coordinates: 108542908-108546547 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1752 bp · TkA07G429020|TK1151|cDNA

GCCCATAAATAAATCAGCTTACGAGACTCTCCTATTGGCCCATTACAATCTCCACCAAAAAAATCAGAGCTCAAGCGGAGGAGCTCTCGCCATCTCCACCCCATATCCTCCATAGCTCCGGCCAGTCATCTTATCAGCAAGTGGTTACTCCTTACTCGCATCTACGTTACAGATTAGTTCAGGAACTTCAACGTACTAGTTTCAGAACCCTCATGGGGCGTAATTCCTCAGATCATTCACAATCTCCAGTTAGGAATCAC...

CDS

Download CDS FASTA

1137 bp · TkA07G429020|TK1151|CDS

ATGGGGCGTAATTCCTCAGATCATTCACAATCTCCAGTTAGGAATCACAGGTCATCTCACAGGAGAGATAGATCGCCACCTCAGCACAAAAGCTCACACTCAACAAGATCACCAGGTAAAGAAAGACCTTCATCTTCACGACACCCAAAGCCTCCTCCTACTCATTCACCAGTTAAAGAGAAACATTCAAGGTCCTCAAAGCACACCAGATCAAGGTCTCGCTCTCCTAAACATCACTTACCTGTACCTTCAGCTCCTGT...

Protein

Download Protein FASTA

378 aa · TkA07G429020|TK1151|PROTEIN

MGRNSSDHSQSPVRNHRSSHRRDRSPPQHKSSHSTRSPGKERPSSSRHPKPPPTHSPVKEKHSRSSKHTRSRSRSPKHHLPVPSAPVKETSRSPSPRSKRLRRNDKSSERGHDKSKTRSPPPVSNHSRSPSPRTRRLQRAQSDKTSHKDKDSENDRHDRKSGRSTDGNGSSKGHKSRHRFESPPPAARDEGNNSIGDNRNGNDEDDSVAQMKAAEEALATKEKQKPSFELSGKLAAETNRVKGVTLLFTEPPDARKPEVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G429020`
TK1151 ID	TkA07G429020
OH-1004 ID	LXL04_030759
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G429020

Location Chr07:108542908-108546547 (-)

Description Similar to DDL: FHA domain-containing protein DDL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20550`	Involved in the microRNA (miRNA) and short interfering RNA (siRNA) biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030759 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0035196 miRNA processing Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0051301 cell division Biological Process

GO:1903241 U2-type prespliceosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

KEGG gene cross-reference

ath:AT3G20550

ddi:DDB_G0280133

hsa:79753

mmu:76793

rno:313588

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA07G429020 · TK1151

Cytoplasm0.119

Rank 2 · TkA07G429020 · TK1151

Cell membrane0.019

Rank 3 · TkA07G429020 · TK1151

Mitochondrion0.010

Rank 4 · TkA07G429020 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA07G429020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16697Yop-YscD_cpl283-365 aa

PF00498FHA284-364 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G429020	`PF16697`	Yop-YscD_cpl	283	365	0.076	14.1
TkA07G429020	`PF00498`	FHA	284	364	2.4e-17	63.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4D8`	Arabidopsis thaliana	sp\|Q8W4D8\|DDL_ARATH FHA domain-containing protein DDL	76.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card