Gene Card
Gene overview
cDNA / CDS / Protein Sequences
510 bp · TkA07G426860|TK1151|cDNA
ATGAATATGAAATCGGCGCAAGCGTCGTCTTACAGAGATCGTACACAGGAGGTTTCGAGCATAGTGGAGAGACTTAAAAAATGGATATCGCCGTCGAATGCGGTAGCAGGGGTTACTAGCAGTGGAGGTGTTGGGGGTGGTGCTGGTAGCTCCACCAAGATTGAGGGATCTCGATCAACTGTCGCATTTCAATCAGAGTTTAACAAGAGGGCTTCCAAAATCGGGTATGGCATTCACCACACATCGCAGAAGCTGGCCAA...
510 bp · TkA07G426860|TK1151|CDS
ATGAATATGAAATCGGCGCAAGCGTCGTCTTACAGAGATCGTACACAGGAGGTTTCGAGCATAGTGGAGAGACTTAAAAAATGGATATCGCCGTCGAATGCGGTAGCAGGGGTTACTAGCAGTGGAGGTGTTGGGGGTGGTGCTGGTAGCTCCACCAAGATTGAGGGATCTCGATCAACTGTCGCATTTCAATCAGAGTTTAACAAGAGGGCTTCCAAAATCGGGTATGGCATTCACCACACATCGCAGAAGCTGGCCAA...
Protein
Download Protein FASTA169 aa · TkA07G426860|TK1151|PROTEIN
MNMKSAQASSYRDRTQEVSSIVERLKKWISPSNAVAGVTSSGGVGGGAGSSTKIEGSRSTVAFQSEFNKRASKIGYGIHHTSQKLAKLAKLAKRTSVFDDPTMEIQELTAVIKQDITALNSAVVDLQLVCNSQNQTENISSDTAPTKKSVLNVFLFNCQIACSNVPFFM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G426860 |
|---|---|
| TK1151 ID | TkA07G426860 |
| OH-1004 ID | LXL04_028009 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 93.400 |
| Protein coverage (%) | TK1151 89.941 / OH-1004 43.305Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G426860 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:107937803-107938960 (-) | |||||||||
| Description | Similar to SYP32: Syntaxin-32 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process GO:0006906 vesicle fusion Biological Process GO:0034498 early endosome to Golgi transport Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0045732 positive regulation of protein catabolic process Biological Process GO:0048278 vesicle docking Biological Process GO:0061025 membrane fusion Biological Process GO:0090166 Golgi disassembly Biological Process GO:1903358 regulation of Golgi organization Biological Process GO:0000139 Golgi membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G24350 ath:AT5G05760 bta:510312 hsa:6811 spo:2541263 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11416Syntaxin-5_N6-27 aaPF16752TBCC_N6-30 aaPF14523Syntaxin_212-30 aaPF30250DegR16-27 aaPF27021BOS1_GOSR2_MEM11-like_N16-24 aaPF19012DUF574120-26 aaPF14523Syntaxin_253-93 aaPF13990YjcZ56-140 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G426860 | PF11416 | Syntaxin-5_N | 6 | 27 | 0.012 | 15.6 |
| TkA07G426860 | PF16752 | TBCC_N | 6 | 30 | 0.11 | 13.5 |
| TkA07G426860 | PF14523 | Syntaxin_2 | 12 | 30 | 0.32 | 11.7 |
| TkA07G426860 | PF30250 | DegR | 16 | 27 | 0.035 | 14.9 |
| TkA07G426860 | PF27021 | BOS1_GOSR2_MEM11-like_N | 16 | 24 | 0.059 | 14.4 |
| TkA07G426860 | PF19012 | DUF5741 | 20 | 26 | 0.12 | 13.0 |
| TkA07G426860 | PF14523 | Syntaxin_2 | 53 | 93 | 0.32 | 11.7 |
| TkA07G426860 | PF13990 | YjcZ | 56 | 140 | 0.11 | 12.6 |
| TkA07G426860 | PF16752 | TBCC_N | 57 | 120 | 0.11 | 13.5 |
| TkA07G426860 | PF27021 | BOS1_GOSR2_MEM11-like_N | 78 | 135 | 0.059 | 14.4 |
| TkA07G426860 | PF30250 | DegR | 85 | 120 | 0.035 | 14.9 |
| TkA07G426860 | PF19012 | DUF5741 | 89 | 118 | 0.12 | 13.0 |
| TkA07G426860 | PF14523 | Syntaxin_2 | 104 | 134 | 0.32 | 11.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.