TkA07G426550 | RubberDandelionOmics

Gene overview

TkA07G426550

Reference: TK1151 Chr: Chr07 Coordinates: 107861182-107863504 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA07G426550|TK1151|cDNA

ATCTCTGCACACACTACAACACACAGATATTCGAAGATGGCGATGCAGATGGCAAGAGTAGGAGATCGTGGATTCAGGGATAAAATGGCGGAACTTCGACTGATTTCCGACAAAGAAATTGAGATTCAGGAGCGGAGGATTGAAACTTCCGCTCTTTCATTGCGTAAATCCCTTCAGTCAATCAAGTCCGGTGCCCAGGAAACCGTGTTAAATCAAGAGAAGATAGGAAAGCTCAAATCTCAACTGAGGGCAGTGGAGGA...

CDS

Download CDS FASTA

912 bp · TkA07G426550|TK1151|CDS

ATGGCGATGCAGATGGCAAGAGTAGGAGATCGTGGATTCAGGGATAAAATGGCGGAACTTCGACTGATTTCCGACAAAGAAATTGAGATTCAGGAGCGGAGGATTGAAACTTCCGCTCTTTCATTGCGTAAATCCCTTCAGTCAATCAAGTCCGGTGCCCAGGAAACCGTGTTAAATCAAGAGAAGATAGGAAAGCTCAAATCTCAACTGAGGGCAGTGGAGGATCATTTGGTGAAAGCTCTTTCTGTAAAGACACGTAA...

Protein

Download Protein FASTA

303 aa · TkA07G426550|TK1151|PROTEIN

MAMQMARVGDRGFRDKMAELRLISDKEIEIQERRIETSALSLRKSLQSIKSGAQETVLNQEKIGKLKSQLRAVEDHLVKALSVKTRKEAKKMAIADSISATKARLEEHKKIVVDQRTRKDEFAEIISQQSEALKEIEEKHNQDAECREEIEEAISWYNTVLGFRIETGPGIKFIFNNINKKNLKEEYYFTIRLENDIYSLLDCHPNVSDTKMLIQELNATNGLYKFVRSMRAKFQEFAVIGNLGENVQETCTVSMSAPFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G426550`
TK1151 ID	TkA07G426550
OH-1004 ID	LXL04_030730
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.010 / OH-1004 90.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G426550

Location Chr07:107861182-107863504 (+)

Description Similar to SPC25: Kinetochore protein SPC25 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48210`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030730 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore Biological Process

GO:0051301 cell division Biological Process

GO:0051455 spindle attachment to meiosis I kinetochore Biological Process

GO:1990571 meiotic centromere clustering Biological Process

GO:0000776 kinetochore Cellular Component

GO:0000779 condensed chromosome, centromeric region Cellular Component

GO:0000940 outer kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0031262 Ndc80 complex Cellular Component

KEGG gene cross-reference

ath:AT3G48210

spo:2539200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.924

Rank 1 · TkA07G426550 · TK1151

Cytoplasm0.155

Rank 2 · TkA07G426550 · TK1151

Mitochondrion0.020

Rank 3 · TkA07G426550 · TK1151

Cell membrane0.019

Rank 4 · TkA07G426550 · TK1151

Golgi apparatus0.009

Rank 5 · TkA07G426550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04344CheZ11-87 aa

PF13907CHD1-like_C39-91 aa

PF04344CheZ41-146 aa

PF29057SYN8_N42-68 aa

PF29562DUF856761-174 aa

PF29057SYN8_N75-143 aa

PF06497Baculo_Ac102109-145 aa

PF13907CHD1-like_C117-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G426550	`PF04344`	CheZ	11	87	1.3	9.5
TkA07G426550	`PF13907`	CHD1-like_C	39	91	0.81	10.9
TkA07G426550	`PF04344`	CheZ	41	146	1.3	9.5
TkA07G426550	`PF29057`	SYN8_N	42	68	0.52	11.5
TkA07G426550	`PF29562`	DUF8567	61	174	0.63	10.6
TkA07G426550	`PF29057`	SYN8_N	75	143	0.52	11.5
TkA07G426550	`PF06497`	Baculo_Ac102	109	145	0.025	15.3
TkA07G426550	`PF13907`	CHD1-like_C	117	149	0.81	10.9
TkA07G426550	`PF29057`	SYN8_N	123	161	0.52	11.5
TkA07G426550	`PF18045`	ISP3_C	139	181	0.092	13.5
TkA07G426550	`PF08234`	Spindle_Spc25	170	235	6.9e-21	75.0
TkA07G426550	`PF29057`	SYN8_N	195	228	0.52	11.5
TkA07G426550	`PF29562`	DUF8567	206	236	0.63	10.6
TkA07G426550	`PF06497`	Baculo_Ac102	209	227	0.025	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VK9`	Arabidopsis thaliana	sp\|Q93VK9\|SPC25_ARATH Kinetochore protein SPC25 homolog	37.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card