TkA07G426000 | RubberDandelionOmics

Gene overview

TkA07G426000

Reference: TK1151 Chr: Chr07 Coordinates: 107701482-107703526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1584 bp · TkA07G426000|TK1151|cDNA

AGAATATCCTCATTGGAAGTTGAATGAACTACAACGGGCATTGTTCATGAGAATGAAGTTATTTAAATAGATTCATCATTGAAATCATGGTCTTTATTAGAAGGTTCGTTCTTTTTCAAAACTAATATGTACACATGGATTTATACACCAGGACAAGGATAAAATATGGTTTTTTGAAGATCAAAATACACAATCAAATCACCACTTCATTCTTTACAAAATGATTTTAAGTGACCATATTTCCTTTGGTCGCAAAGAAA...

CDS

Download CDS FASTA

864 bp · TkA07G426000|TK1151|CDS

ATGCATTCGGTAAGCTTAAAGTTGTTTGTGGATTTCAACGATGTCAAATCGAGGCATACGATGCCAAGTCAGGTTAGTTTTGGTGCGGGAGAACCTCCGGTTAGGTTGAATTTCGGAGATCAAGGGAGGAGGAGCTGTAGAATCGTTGCGCATGCTTCGGAGAGAGATGCCGGTGCTGGTGCCGGGGCTGAGGCTGGTGAGAGTCAGCAAAATAAGAGCTCGTTTTTCGCACGGAGTCAAACTTACGCTTTGATGAAACA...

Protein

Download Protein FASTA

287 aa · TkA07G426000|TK1151|PROTEIN

MHSVSLKLFVDFNDVKSRHTMPSQVSFGAGEPPVRLNFGDQGRRSCRIVAHASERDAGAGAGAEAGESQQNKSSFFARSQTYALMKQQMELAAKSENFEEAARLRDSLKSFEEEEPVLRLRGLMKEAIANENFEDAARYRDQIKQIAPHYLLKCSSDATTLGIRVQVRSVYIEGRSQPLRGQYFFAYRIRITNNSNRPVQLLKRHWIITNANEKSEDVWGIGVIGEQPVILPNNSFEYSSACPLTTPSGRMEGDFEMKHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G426000`
TK1151 ID	TkA07G426000
OH-1004 ID	LXL04_030723
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G426000`
Location	Chr07:107701482-107703526 (+)
Description	Similar to apaG: Protein ApaG (Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030723` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0070987 error-free translesion synthesis Biological Process
KEGG gene cross-reference	atu:Atu0431 bcs:BCAN_A0310 bmt:BSUIS_A0330 mag:amb4224 mmr:Mmar10_0491 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.964

Rank 1 · TkA07G426000 · TK1151

Mitochondrion0.055

Rank 2 · TkA07G426000 · TK1151

Cytoplasm0.027

Rank 3 · TkA07G426000 · TK1151

Nucleus0.024

Rank 4 · TkA07G426000 · TK1151

Peroxisome0.013

Rank 5 · TkA07G426000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29231DUF851778-114 aa

PF02151UVR85-113 aa

PF20663COG4_N87-107 aa

PF29231DUF8517119-140 aa

PF02151UVR120-146 aa

PF20663COG4_N125-149 aa

PF04379DUF525175-258 aa

PF09478CBM49181-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G426000	`PF29231`	DUF8517	78	114	0.01	16.4
TkA07G426000	`PF02151`	UVR	85	113	4.2e-17	62.0
TkA07G426000	`PF20663`	COG4_N	87	107	0.085	13.6
TkA07G426000	`PF29231`	DUF8517	119	140	0.01	16.4
TkA07G426000	`PF02151`	UVR	120	146	4.2e-17	62.0
TkA07G426000	`PF20663`	COG4_N	125	149	0.085	13.6
TkA07G426000	`PF04379`	DUF525	175	258	5.7e-33	113.7
TkA07G426000	`PF09478`	CBM49	181	232	0.11	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card