TkA07G425850 | RubberDandelionOmics

Gene overview

TkA07G425850

Reference: TK1151 Chr: Chr07 Coordinates: 107643307-107645178 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1433 bp · TkA07G425850|TK1151|cDNA

CATTGCATACTTCACATTTACTCTCTATCTCTCTTCTTGTCTCTAATATACACACATTCTCACACACTCACTGTGTGTGAGGTTTTCACTTCTGTTTTTAGAACGATTCCACTTGGGTTTCTTTTCTTGTTTTCAGATAATATGGGTTTAACGTCTCTTCAAGTCTGTATGGACTCTTCTGACTGGTTTCAGGGTACAATTCAGGAAGAAATAGGAATGGATTCATCATCACCTTCAGGAATGACGGATCCCATGCTTGC...

CDS

Download CDS FASTA

1164 bp · TkA07G425850|TK1151|CDS

CATTGCATACTTCACATTTACTCTCTATCTCTCTTCTTGTCTCTAATATACACACATTCTCACACACTCACTGTGTGTGAGGTTTTCACTTCTGTTTTTAGAACGATTCCACTTGGGTTTCTTTTCTTGTTTTCAGATAATATGGGTTTAACGTCTCTTCAAGTCTGTATGGACTCTTCTGACTGGTTTCAGGGTACAATTCAGGAAGAAATAGGAATGGATTCATCATCACCTTCAGGAATGACGGATCCCATGCTTGC...

Protein

Download Protein FASTA

387 aa · TkA07G425850|TK1151|PROTEIN

HCILHIYSLSLFLSLIYTHSHTLTVCEVFTSVFRTIPLGFLFLFSDNMGLTSLQVCMDSSDWFQGTIQEEIGMDSSSPSGMTDPMLACSRPLMERRLRPQQDQALKCPRCDSTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKVSSNSKKSTSATANNDNNVNIHHQTQQHNPHLINPNHNLIMNSTDLQLSYPESSMQFAASNLFGIGNPSNIPSFMFENLNSSATRAIDFMENNGGNVGGGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G425850`
TK1151 ID	TkA07G425850
OH-1004 ID	LXL04_030717
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.800
Protein coverage (%)	TK1151 96.899 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G425850

Location Chr07:107643307-107645178 (+)

Description Similar to DOF5.6: Dof zinc finger protein DOF5.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62940`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Dof5.6/HCA2, a Dof transcription factor gene, regulates interfascicular cambium formation and vascular tissue development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.064139 Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At5g60200`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Mobile PEAR transcription factors integrate positional cues to prime cambial growth.2019 · DOI: 10.1038/s41586-018-0839-y
`At4g24060`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0567800`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0090057 root radial pattern formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G45610

ath:AT4G24060

ath:AT5G60200

ath:AT5G62940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · TkA07G425850 · TK1151

Cytoplasm0.119

Rank 2 · TkA07G425850 · TK1151

Cell membrane0.026

Rank 3 · TkA07G425850 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA07G425850 · TK1151

Plastid0.011

Rank 5 · TkA07G425850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14369Zn_ribbon_1996-112 aa

PF23451Zn_ribbon_PaaD100-136 aa

PF02701Zn_ribbon_Dof102-159 aa

PF27208TP_0214106-137 aa

PF14369Zn_ribbon_19129-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G425850	`PF14369`	Zn_ribbon_19	96	112	1.9	9.5
TkA07G425850	`PF23451`	Zn_ribbon_PaaD	100	136	0.0025	18.1
TkA07G425850	`PF02701`	Zn_ribbon_Dof	102	159	7e-34	116.5
TkA07G425850	`PF27208`	TP_0214	106	137	0.31	11.5
TkA07G425850	`PF14369`	Zn_ribbon_19	129	140	1.9	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM03`	Arabidopsis thaliana	sp\|Q9FM03\|DOF56_ARATH Dof zinc finger protein DOF5.6	39.800%	Swiss-Prot	Medium
`Q84TE9`	Arabidopsis thaliana	sp\|Q84TE9\|DOF53_ARATH Dof zinc finger protein DOF5.3	82.400%	Swiss-Prot	Low
`Q8LAP8`	Arabidopsis thaliana	sp\|Q8LAP8\|DOF46_ARATH Dof zinc finger protein DOF4.6	58.100%	Swiss-Prot	Low
`Q9SXG8`	Oryza sativa subsp. japonica	sp\|Q9SXG8\|DOF1_ORYSJ Dof zinc finger protein 1	81.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card