TkA07G425150 | RubberDandelionOmics

Gene overview

TkA07G425150

Reference: TK1151 Chr: Chr07 Coordinates: 107490867-107495110 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1839 bp · TkA07G425150|TK1151|cDNA

ATGCCAATGACCATCAGTAGTTTCGACATGATTATCGGGATGGATTGGCTAGAACCTAATCACGCTGACATCATGTGCTACAAGAAAGCAGTGCGACTAAATTTACCTAACGGCGACAAGATGATTGTGTACGGCGACAAGTCGGGTGACAACCTTAGGGTAATCTCGTGCATGAAGGCTCAAAAGTACTTACACAAGAAGTGCTATGCATTCTTGGCGCATATCATAGATAAGAGCAAGGAACCAAAGAAGATCCAAGA...

CDS

Download CDS FASTA

1839 bp · TkA07G425150|TK1151|CDS

ATGCCAATGACCATCAGTAGTTTCGACATGATTATCGGGATGGATTGGCTAGAACCTAATCACGCTGACATCATGTGCTACAAGAAAGCAGTGCGACTAAATTTACCTAACGGCGACAAGATGATTGTGTACGGCGACAAGTCGGGTGACAACCTTAGGGTAATCTCGTGCATGAAGGCTCAAAAGTACTTACACAAGAAGTGCTATGCATTCTTGGCGCATATCATAGATAAGAGCAAGGAACCAAAGAAGATCCAAGA...

Protein

Download Protein FASTA

612 aa · TkA07G425150|TK1151|PROTEIN

MPMTISSFDMIIGMDWLEPNHADIMCYKKAVRLNLPNGDKMIVYGDKSGDNLRVISCMKAQKYLHKKCYAFLAHIIDKSKEPKKIQDISHVCDFPDVFPEDLPGLPPTRQVEFRIDLIPRAAPIARSPYRLAPSEMQELSSQLQELLSKGFVRPSFSPWGAPVLFVKKKDGTFRMCIDYPELNKLTVKNRYPLPRIDDLFDQLQGSTHFSKIDLRSGYHQLNIPKTAFRTRYGHYEFLVMLFGLTNAPAVFMDLVNRVCR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G425150`
TK1151 ID	TkA07G425150
OH-1004 ID	LXL04_008128
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.200
Protein coverage (%)	TK1151 100.000 / OH-1004 42.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G425150`
Location	Chr07:107490867-107495110 (+)
Description	Similar to TY3B-I: Transposon Ty3-I Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008128` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function
KEGG gene cross-reference	sce:YGR109W-B sce:YIL082W-A spo:2538755 spo:2541833 spo:2541991 spo:3361422 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · TkA07G425150 · TK1151

Nucleus0.222

Rank 2 · TkA07G425150 · TK1151

Mitochondrion0.123

Rank 3 · TkA07G425150 · TK1151

Peroxisome0.064

Rank 4 · TkA07G425150 · TK1151

Cell membrane0.051

Rank 5 · TkA07G425150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08284RVP_23-34 aa

PF00078RVT_1166-320 aa

PF17917RT_RNaseH271-294 aa

PF17919RT_RNaseH_2382-461 aa

PF17917RT_RNaseH394-491 aa

PF13456RVT_3408-511 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G425150	`PF08284`	RVP_2	3	34	3.8e-05	24.2
TkA07G425150	`PF00078`	RVT_1	166	320	1.3e-31	110.8
TkA07G425150	`PF17917`	RT_RNaseH	271	294	8.1e-34	116.7
TkA07G425150	`PF17919`	RT_RNaseH_2	382	461	9.1e-23	80.9
TkA07G425150	`PF17917`	RT_RNaseH	394	491	8.1e-34	116.7
TkA07G425150	`PF13456`	RVT_3	408	511	0.058	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card