TkA07G424740 | RubberDandelionOmics

Gene overview

TkA07G424740

Reference: TK1151 Chr: Chr07 Coordinates: 107393543-107396408 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · TkA07G424740|TK1151|cDNA

TTGCCTCTTAGATTTCTTCTTTTAGGGCTCAGTCTTTTTTCTTTTTCAATCCCAAAACCTTCATCTCCATTTAAGTAATTTGTTTGCTTGAAATTTCTTCATGTACATATAAATACACAAAATATATATATATACACATTTATTTGATATTTGATATTGATATATCATCGTCACTTCTGGTTTGCTACACCCGATAACTACAGATGGGGCCCGAAACCATAAGATTCATCGTTGGGATCGTCGGAAATATCATTTCATTA...

CDS

Download CDS FASTA

714 bp · TkA07G424740|TK1151|CDS

ATGGGGCCCGAAACCATAAGATTCATCGTTGGGATCGTCGGAAATATCATTTCATTATATCTATATCTTTCTCCGACACCAACATTTGTAAAAATTGTGAAATATAAATCTGTACAAGCATTCAAGCCAGATCCATATCTTGCCACTCTTTTAAATTGTGTGATGTGGATCTTCTATGGCCTCCCCGTTGTTCATCCACATAGTCTTCTCATCGTTACAGTTAACAGTGCTGGAGTGCTCATTAACGTCACATTTTGCAC...

Protein

Download Protein FASTA

237 aa · TkA07G424740|TK1151|PROTEIN

MGPETIRFIVGIVGNIISLYLYLSPTPTFVKIVKYKSVQAFKPDPYLATLLNCVMWIFYGLPVVHPHSLLIVTVNSAGVLINVTFCTIFFRYCGWPCRKKMIIAFILEILFIAGMVAVTLTLEHTHPARSMLVGILCVILNIAMYMSPLTVVKTVIKTKSVKYMPIFLSVGNLLNGSIWLVYASLDFDPYIMIPNVLGTISGIIQIGLYIKYNKTTNWDDEEEPPNGVEMPPAASNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G424740`
TK1151 ID	TkA07G424740
OH-1004 ID	LXL04_030705
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G424740

Location Chr07:107393543-107396408 (+)

Description Similar to SWEET5: Bidirectional sugar transporter SWEET5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62850`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane (By similarity).	No verified direct reference in this release
`At4g10850`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YZ24`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os09g0258700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os01g0605700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G10850

ath:AT5G62850

dosa:Os01g0605700

dosa:Os09g0258700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785

Rank 1 · TkA07G424740 · TK1151

Cytoplasm0.104

Rank 2 · TkA07G424740 · TK1151

Endoplasmic reticulum0.083

Rank 3 · TkA07G424740 · TK1151

Lysosome / Vacuole0.060

Rank 4 · TkA07G424740 · TK1151

Golgi apparatus0.045

Rank 5 · TkA07G424740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv9-93 aa

PF11990DUF348747-91 aa

PF27548Rv0497_C102-136 aa

PF11990DUF3487110-140 aa

PF03083MtN3_slv132-216 aa

PF11990DUF3487182-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G424740	`PF03083`	MtN3_slv	9	93	1.6e-40	137.7
TkA07G424740	`PF11990`	DUF3487	47	91	0.44	11.1
TkA07G424740	`PF27548`	Rv0497_C	102	136	0.26	12.2
TkA07G424740	`PF11990`	DUF3487	110	140	0.44	11.1
TkA07G424740	`PF03083`	MtN3_slv	132	216	1.6e-40	137.7
TkA07G424740	`PF11990`	DUF3487	182	196	0.44	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM10`	Arabidopsis thaliana	sp\|Q9FM10\|SWET5_ARATH Bidirectional sugar transporter SWEET5	57.000%	Swiss-Prot	High
`Q8LBF7`	Arabidopsis thaliana	sp\|Q8LBF7\|SWET7_ARATH Bidirectional sugar transporter SWEET7	53.300%	Swiss-Prot	High
`A2YZ24`	Oryza sativa subsp. indica	sp\|A2YZ24\|SWT7B_ORYSI Bidirectional sugar transporter SWEET7b	52.300%	Swiss-Prot	High
`Q0J349`	Oryza sativa subsp. japonica	sp\|Q0J349\|SWT7B_ORYSJ Bidirectional sugar transporter SWEET7b	52.600%	Swiss-Prot	High
`Q8W0K2`	Oryza sativa subsp. japonica	sp\|Q8W0K2\|SWT6B_ORYSJ Bidirectional sugar transporter SWEET6b	48.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card