TkA07G423630 | RubberDandelionOmics

Gene overview

TkA07G423630

Reference: TK1151 Chr: Chr07 Coordinates: 107141701-107142967 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · TkA07G423630|TK1151|cDNA

ATGCTATCTGTAAATGAAGAGGCCCATATGGAAATTGCCCCAGAACAAGCTCCTCCTCCTCCTGTAAATCGACTACCCTCCGCCTCCTTCTCCGGCTACAGAACGAGCTCTTCCTCCTCCCTCACAGTCGAATTTCAGGTAATTCCTTTGATTATTCTGTTTCGGAGGTACACAACAACCTTAGTTTCAAGATCTGTTTACACATCTTGGAAATCTTCATCTGCTGCTGGATTGACCGCCACAGTTGCAAAAGAACCAGA...

CDS

Download CDS FASTA

549 bp · TkA07G423630|TK1151|CDS

ATGCTATCTGTAAATGAAGAGGCCCATATGGAAATTGCCCCAGAACAAGCTCCTCCTCCTCCTGTAAATCGACTACCCTCCGCCTCCTTCTCCGGCTACAGAACGAGCTCTTCCTCCTCCCTCACAGTCGAATTTCAGGTAATTCCTTTGATTATTCTGTTTCGGAGGTACACAACAACCTTAGTTTCAAGATCTGTTTACACATCTTGGAAATCTTCATCTGCTGCTGGATTGACCGCCACAGTTGCAAAAGAACCAGA...

Protein

Download Protein FASTA

182 aa · TkA07G423630|TK1151|PROTEIN

MLSVNEEAHMEIAPEQAPPPPVNRLPSASFSGYRTSSSSSLTVEFQVIPLIILFRRYTTTLVSRSVYTSWKSSSAAGLTATVAKEPETGEFCIEAGALMLADMVAIHEAMEQQTISITKAVIQATLNARTSILAAANPTRGSYDKSKPLKVSSGILVFLHYLFNYIYIYIYIYIYIYIYIYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G423630`
TK1151 ID	TkA07G423630
OH-1004 ID	LXL04_003562
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.600
Protein coverage (%)	TK1151 53.297 / OH-1004 13.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G423630

Location Chr07:107141701-107142967 (+)

Description Similar to MCM6: DNA replication licensing factor MCM6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44635`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AZX3`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`Os05g0235800`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006279 premeiotic DNA replication Biological Process

GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process

GO:0044786 cell cycle DNA replication Biological Process

GO:1902969 mitotic DNA replication Biological Process

GO:1902975 mitotic DNA replication initiation Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005656 nuclear pre-replicative complex Cellular Component

KEGG gene cross-reference

ath:AT5G44635

dosa:Os05g0235800

spo:2540784

xtr:548975

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.461

Rank 1 · TkA07G423630 · TK1151

Cytoplasm0.393

Rank 2 · TkA07G423630 · TK1151

Mitochondrion0.115

Rank 3 · TkA07G423630 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA07G423630 · TK1151

Cell membrane0.070

Rank 5 · TkA07G423630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01275Myelin_PLP43-78 aa

PF00493MCM56-150 aa

PF01078Mg_chelatase105-148 aa

PF01275Myelin_PLP139-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G423630	`PF01275`	Myelin_PLP	43	78	0.36	11.3
TkA07G423630	`PF00493`	MCM	56	150	5.9e-33	114.6
TkA07G423630	`PF01078`	Mg_chelatase	105	148	0.0044	17.2
TkA07G423630	`PF01275`	Myelin_PLP	139	181	0.36	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAB8`	Arabidopsis thaliana	sp\|F4KAB8\|MCM6_ARATH DNA replication licensing factor MCM6	75.200%	Swiss-Prot	Medium
`B8AZX3`	Oryza sativa subsp. indica	sp\|B8AZX3\|MCM6_ORYSI DNA replication licensing factor MCM6	76.100%	Swiss-Prot	Medium
`Q6F353`	Oryza sativa subsp. japonica	sp\|Q6F353\|MCM6_ORYSJ DNA replication licensing factor MCM6	76.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card