TkA07G423200 | RubberDandelionOmics

Gene overview

TkA07G423200

Reference: TK1151 Chr: Chr07 Coordinates: 106987399-106989334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1663 bp · TkA07G423200|TK1151|cDNA

ACGAAAGATCGACAGGCGCAAATTATGTCAACGATATTGGTGGCACGATCTGAAAATAGTCAGACACTCAAGGGTATTATTGTAAATTGCCAACTATATAAGAACGACTTCAGGGCAGAGTGGTTCATGTGTTGCCAAAAGGGCGAACGAAGCAGAGCAAATTCCGTTATCTATCCACACCAAAATTCTATCTTTTCTCATTCGCTTAATCCTTGATATCAATCGTTTTCTCTGAATCGATATCTCTGTTTTTCGAGAAA...

CDS

Download CDS FASTA

864 bp · TkA07G423200|TK1151|CDS

ATGTTCGTCGTGAACAGTGGCTTTCTCAAGAACAAGGGGTTTAAGGAAGAAAACCAAAACAAAGGTGATGCTCGTCCAAAAATGCCTGCTTCGGACATGCATGTCCCAAACGAAGGAGATCGATCGCTGGTGAAACTAGTGATCAATCCCGGCGGTGAAGAGAACGATGGTTTAATGAATCATTACAGCGATTGGGAATCTCCTTCCAACAGCCCTACCAGTCACACCAGCAGCATGGGGAGTAACATCTCCATCACCAA...

Protein

Download Protein FASTA

287 aa · TkA07G423200|TK1151|PROTEIN

MFVVNSGFLKNKGFKEENQNKGDARPKMPASDMHVPNEGDRSLVKLVINPGGEENDGLMNHYSDWESPSNSPTSHTSSMGSNISITNMTGSSSRSSSSSGGCYSESLTEEDDNDDGILDDWETIADALAADDIKNHTHNPNPDSPTESELHPVETIKTENCHESQAKNHHHHHRAWRPDDACRPQFLPNLLKQNSFPMNSDRHTPWGFKNSGFAFSPSPCPICCEDLDLTDSSFLPCPCGYRLCLFCHKRILEDNGRCPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G423200`
TK1151 ID	TkA07G423200
OH-1004 ID	LXL04_030685
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 97.213 / OH-1004 85.321 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G423200`
Location	Chr07:106987399-106989334 (+)
Description	Similar to MOT2: General negative regulator of transcription subunit 4 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030685` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006513 protein monoubiquitination Biological Process GO:0010498 proteasomal protein catabolic process Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0051865 protein autoubiquitination Biological Process GO:0070966 nuclear-transcribed mRNA catabolic process, no-go decay Biological Process
KEGG gene cross-reference	hsa:4850 mmu:53621 sce:YER068W spo:2542325 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.660

Rank 1 · TkA07G423200 · TK1151

Cytoplasm0.347

Rank 2 · TkA07G423200 · TK1151

Cell membrane0.135

Rank 3 · TkA07G423200 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA07G423200 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA07G423200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14570zf-RING_4220-266 aa

PF13639zf-RING_2220-262 aa

PF13923zf-C3HC4_2220-261 aa

PF00097zf-C3HC4220-261 aa

PF14569zf-UDP220-269 aa

PF26200Rcat_RNF216231-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G423200	`PF14570`	zf-RING_4	220	266	4.4e-19	68.7
TkA07G423200	`PF13639`	zf-RING_2	220	262	0.00057	20.8
TkA07G423200	`PF13923`	zf-C3HC4_2	220	261	0.043	14.3
TkA07G423200	`PF00097`	zf-C3HC4	220	261	0.079	13.6
TkA07G423200	`PF14569`	zf-UDP	220	269	0.64	10.8
TkA07G423200	`PF26200`	Rcat_RNF216	231	262	0.13	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card