TkA07G422510 | RubberDandelionOmics

Gene overview

TkA07G422510

Reference: TK1151 Chr: Chr07 Coordinates: 106791024-106791578 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA07G422510|TK1151|cDNA

ATGACCCTCAAGGGTGCAACCACCCACGCCTGTGCCGCCTGCAAATACCAACGCAAGCGGTGCAACCCTGACTGTCCCCTTGCACCACACTTCCGACCTGAACACCCTGTGGTTTTCAAAAACGCACACACGCTTTTCGGTGTGAAGAACATCTTACGTATCCTCGAAGTAATCGACCCACACCATAAAACAGAGGCCATGCGGTCCATAATCTATGAGGCAAACATGCGAGATCGGTTTCCAGTCCATGGTTGCCTGAC...

CDS

Download CDS FASTA

555 bp · TkA07G422510|TK1151|CDS

ATGACCCTCAAGGGTGCAACCACCCACGCCTGTGCCGCCTGCAAATACCAACGCAAGCGGTGCAACCCTGACTGTCCCCTTGCACCACACTTCCGACCTGAACACCCTGTGGTTTTCAAAAACGCACACACGCTTTTCGGTGTGAAGAACATCTTACGTATCCTCGAAGTAATCGACCCACACCATAAAACAGAGGCCATGCGGTCCATAATCTATGAGGCAAACATGCGAGATCGGTTTCCAGTCCATGGTTGCCTGAC...

Protein

Download Protein FASTA

184 aa · TkA07G422510|TK1151|PROTEIN

MTLKGATTHACAACKYQRKRCNPDCPLAPHFRPEHPVVFKNAHTLFGVKNILRILEVIDPHHKTEAMRSIIYEANMRDRFPVHGCLTAVYDLRLQIRQAEDELHDVLTLIAFCKQYHEKQQQATSMAHVVSCDSLQLGMSTVVQPDTAPLIYCRHNNATLATEIIHDHEEMFVAFDDIENENPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G422510`
TK1151 ID	TkA07G422510
OH-1004 ID	LXL04_030669
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G422510

Location Chr07:106791024-106791578 (+)

Description Similar to LBD27: LOB domain-containing protein 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47870`	LOB domain-containing protein 27.	No verified direct reference in this release
`At1g65620`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release
`At3g13850`	LOB domain-containing protein 22.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXT0`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release
`Os01g0889400`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0001217 DNA-binding transcription repressor activity Molecular Function

KEGG gene cross-reference

ath:AT3G13850

ath:AT3G27650

ath:AT3G47870

ath:AT5G63090

zma:100037816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.936

Rank 1 · TkA07G422510 · TK1151

Cytoplasm0.143

Rank 2 · TkA07G422510 · TK1151

Cell membrane0.024

Rank 3 · TkA07G422510 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA07G422510 · TK1151

Mitochondrion0.010

Rank 5 · TkA07G422510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB10-105 aa

PF03195LOB118-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G422510	`PF03195`	LOB	10	105	2.4e-32	112.2
TkA07G422510	`PF03195`	LOB	118	122	2.4e-32	112.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STS6`	Arabidopsis thaliana	sp\|Q9STS6\|LBD27_ARATH LOB domain-containing protein 27	57.500%	Swiss-Prot	Medium
`O04479`	Arabidopsis thaliana	sp\|O04479\|AS2_ARATH Protein ASYMMETRIC LEAVES 2	40.800%	Swiss-Prot	Medium
`Q9LRW1`	Arabidopsis thaliana	sp\|Q9LRW1\|LBD22_ARATH LOB domain-containing protein 22	45.100%	Swiss-Prot	Medium
`A2WXT0`	Oryza sativa subsp. indica	sp\|A2WXT0\|LBD6_ORYSI LOB domain-containing protein 6	39.200%	Swiss-Prot	Medium
`Q8LQH4`	Oryza sativa subsp. japonica	sp\|Q8LQH4\|LBD6_ORYSJ LOB domain-containing protein 6	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card