TkA07G421550 | RubberDandelionOmics

Gene overview

TkA07G421550

Reference: TK1151 Chr: Chr07 Coordinates: 106534026-106534346 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA07G421550|TK1151|cDNA

ATGGCAGAAAAAAACCTCGAATCCCCTGTTTCAAATTGTGTGATAGGGATTCCATCATACTTCACAGACTCACAAAGGCGTGCTTACCTAGATGCTGCACATATAGCCGGATTAAAACCCTTAAGATTAATGCACGATTGTACTGCAATTACATTAGGTTATGGAATCTACAAAACCGATTTATCCAATTCAAGCCCCACAAATGTAGTCTTTGTTGACATCGGACACTGTGACACTCAAGTAACAGTTGCAGCTTCGTT...

CDS

Download CDS FASTA

321 bp · TkA07G421550|TK1151|CDS

ATGGCAGAAAAAAACCTCGAATCCCCTGTTTCAAATTGTGTGATAGGGATTCCATCATACTTCACAGACTCACAAAGGCGTGCTTACCTAGATGCTGCACATATAGCCGGATTAAAACCCTTAAGATTAATGCACGATTGTACTGCAATTACATTAGGTTATGGAATCTACAAAACCGATTTATCCAATTCAAGCCCCACAAATGTAGTCTTTGTTGACATCGGACACTGTGACACTCAAGTAACAGTTGCAGCTTCGTT...

Protein

Download Protein FASTA

106 aa · TkA07G421550|TK1151|PROTEIN

MAEKNLESPVSNCVIGIPSYFTDSQRRAYLDAAHIAGLKPLRLMHDCTAITLGYGIYKTDLSNSSPTNVVFVDIGHCDTQVTVAASFEETGNQILWLLNQFYRKEQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G421550`
TK1151 ID	TkA07G421550
OH-1004 ID	LXL04_030651
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 55.208 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G421550

Location Chr07:106534026-106534346 (-)

Description Similar to HSP70-16: Heat shock 70 kDa protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11660`	Heat shock 70 kDa protein 16.	No verified direct reference in this release
`At1g79930`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At1g79920`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030651 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:0045345 positive regulation of MHC class I biosynthetic process Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0061098 positive regulation of protein tyrosine kinase activity Biological Process

GO:0070507 regulation of microtubule cytoskeleton organization Biological Process

GO:1903748 negative regulation of establishment of protein localization to mitochondrion Biological Process

GO:1903753 negative regulation of p38MAPK cascade Biological Process

GO:1904276 regulation of wax biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G11660

ath:AT1G79920

ath:AT1G79930

mmu:15505

rno:288444

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA07G421550 · TK1151

Nucleus0.206

Rank 2 · TkA07G421550 · TK1151

Endoplasmic reticulum0.122

Rank 3 · TkA07G421550 · TK1151

Mitochondrion0.095

Rank 4 · TkA07G421550 · TK1151

Lysosome / Vacuole0.091

Rank 5 · TkA07G421550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP702-84 aa

PF16836PSY33-68 aa

PF06723MreB_Mbl9-84 aa

PF27642CNOT11_N47-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G421550	`PF00012`	HSP70	2	84	7.8e-26	91.2
TkA07G421550	`PF16836`	PSY3	3	68	0.032	14.6
TkA07G421550	`PF06723`	MreB_Mbl	9	84	8.2e-05	22.3
TkA07G421550	`PF27642`	CNOT11_N	47	82	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAB1`	Arabidopsis thaliana	sp\|Q9SAB1\|HSP7Q_ARATH Heat shock 70 kDa protein 16	78.700%	Swiss-Prot	High
`Q9S7C0`	Arabidopsis thaliana	sp\|Q9S7C0\|HSP7O_ARATH Heat shock 70 kDa protein 14	64.300%	Swiss-Prot	High
`F4HQD4`	Arabidopsis thaliana	sp\|F4HQD4\|HSP7P_ARATH Heat shock 70 kDa protein 15	61.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card