TkA07G419130 | RubberDandelionOmics

Gene overview

TkA07G419130

Reference: TK1151 Chr: Chr07 Coordinates: 105875212-105876650 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

782 bp · TkA07G419130|TK1151|cDNA

TCTCACCCAACAACAAAACAACACAAAAAATGAACAAAAAAGAAAGCACTTTATCGAAGGCTTTGAAGCTCGGTTTTTCTCCTTATCATCATATCCATGGCAGAAGCAATTATGAGCTTCAAAATCATCACTCCTCACATTCATCATAAACCCTCTTTGCAGACAACAAGATTTGACTTGAATCCATTATCAAAATCACTCAGGCAGGTTTCAGGCTCAACATTCGTCAATGGCTTCCAACTGAAATCGTTTGGTGAAGA...

CDS

Download CDS FASTA

555 bp · TkA07G419130|TK1151|CDS

ATGGCAGAAGCAATTATGAGCTTCAAAATCATCACTCCTCACATTCATCATAAACCCTCTTTGCAGACAACAAGATTTGACTTGAATCCATTATCAAAATCACTCAGGCAGGTTTCAGGCTCAACATTCGTCAATGGCTTCCAACTGAAATCGTTTGGTGAAGATAGCAAAAGGAGTGGATTGAAAGCTCTACCAGATTTGACATTAATGGCGGTTTTGGTCGAGCACATGGAAGGCCAAAGAGACCTCATTACCCACAA...

Protein

Download Protein FASTA

184 aa · TkA07G419130|TK1151|PROTEIN

MAEAIMSFKIITPHIHHKPSLQTTRFDLNPLSKSLRQVSGSTFVNGFQLKSFGEDSKRSGLKALPDLTLMAVLVEHMEGQRDLITHKSIWHLNDQTIKNVYTLYIMFTVWGCCFFGAMKDPYYDSEYYRKDGGDGTGHWVYEKQEDIEENARAELWREELIEEIEQKVGGLRELEEAKEEELVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G419130`
TK1151 ID	TkA07G419130
OH-1004 ID	LXL04_030622
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G419130

Location Chr07:105875212-105876650 (+)

Description Similar to PNSB4: Photosynthetic NDH subunit of subcomplex B 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18730`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030622 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone) Cellular Component

KEGG gene cross-reference

ath:AT1G18730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.829

Rank 1 · TkA07G419130 · TK1151

Mitochondrion0.103

Rank 2 · TkA07G419130 · TK1151

Nucleus0.061

Rank 3 · TkA07G419130 · TK1151

Cytoplasm0.024

Rank 4 · TkA07G419130 · TK1151

Cell membrane0.015

Rank 5 · TkA07G419130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28701PnsB4_N72-118 aa

PF30561DUF8629112-140 aa

PF28702PnsB4_C139-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G419130	`PF28701`	PnsB4_N	72	118	5.9e-32	109.9
TkA07G419130	`PF30561`	DUF8629	112	140	0.0017	18.8
TkA07G419130	`PF28702`	PnsB4_C	139	180	1.4e-21	77.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXS1`	Arabidopsis thaliana	sp\|Q8RXS1\|PNSB4_ARATH Photosynthetic NDH subunit of subcomplex B 4, chloroplastic	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card