Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1503 bp · TkA07G415550|TK1151|cDNA
ATGATAAAATCTCAATACCAACAGGAGGTCCGAGTCCTACAATCAGATAATGGAGGGGAGTACATCAACCATGACATGGAGAAATTCTGCAAATATAACTCCATTCGACATCAGACATTATGCGCCGGATCTCCCCAACAAAATGGGCTCCCAGAAAGAAGAAACCGACAACTTCTAGAAGTTGTTCGAGCATCACTATTTGATATGAAGGTTCCAAGGGAATACTGGGGAGAAGCTGTACGATCAGCTACATATCTTAT...
1503 bp · TkA07G415550|TK1151|CDS
ATGATAAAATCTCAATACCAACAGGAGGTCCGAGTCCTACAATCAGATAATGGAGGGGAGTACATCAACCATGACATGGAGAAATTCTGCAAATATAACTCCATTCGACATCAGACATTATGCGCCGGATCTCCCCAACAAAATGGGCTCCCAGAAAGAAGAAACCGACAACTTCTAGAAGTTGTTCGAGCATCACTATTTGATATGAAGGTTCCAAGGGAATACTGGGGAGAAGCTGTACGATCAGCTACATATCTTAT...
Protein
Download Protein FASTA500 aa · TkA07G415550|TK1151|PROTEIN
MIKSQYQQEVRVLQSDNGGEYINHDMEKFCKYNSIRHQTLCAGSPQQNGLPERRNRQLLEVVRASLFDMKVPREYWGEAVRSATYLINRTPSRVIEFKTPYQKLHEMLDAQGNIDRYKARLVAKGYTQRYGIDYRDMFAPVAKMNTIRILVSLAADQNWPFHQYDVKNAFLNGYLEEEVFMEPPPGINCGGKVCRLKKALYGPKQSPRAWFGRFLNFMKKIGYNQSDADHTLFRVHKREYKITKTSNKKVTALIVYVDDM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G415550 |
|---|---|
| TK1151 ID | TkA07G415550 |
| OH-1004 ID | LXL04_034312 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 47.100 |
| Protein coverage (%) | TK1151 69.600 / OH-1004 15.225Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G415550 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:105047802-105050641 (-) | ||||||||||||
| Description | Similar to At3g54460: F-box protein At3g54460 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0071897 DNA biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0042575 DNA polymerase complex Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004386 helicase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G54460 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00665rve3-45 aaPF29688TnsB_C11-60 aaPF11038DGF-1_557-105 aaPF08847Crr696-161 aaPF07727RVT_2110-275 aaPF29358BamC-like_N223-283 aaPF24494DUF7587229-252 aaPF29688TnsB_C400-444 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G415550 | PF00665 | rve | 3 | 45 | 4.6e-07 | 30.8 |
| TkA07G415550 | PF29688 | TnsB_C | 11 | 60 | 0.0012 | 19.4 |
| TkA07G415550 | PF11038 | DGF-1_5 | 57 | 105 | 0.25 | 12.1 |
| TkA07G415550 | PF08847 | Crr6 | 96 | 161 | 0.22 | 11.9 |
| TkA07G415550 | PF07727 | RVT_2 | 110 | 275 | 1.1e-43 | 150.4 |
| TkA07G415550 | PF29358 | BamC-like_N | 223 | 283 | 0.18 | 11.9 |
| TkA07G415550 | PF24494 | DUF7587 | 229 | 252 | 0.096 | 13.6 |
| TkA07G415550 | PF29688 | TnsB_C | 400 | 444 | 0.0012 | 19.4 |
| TkA07G415550 | PF00665 | rve | 402 | 424 | 4.6e-07 | 30.8 |
| TkA07G415550 | PF24494 | DUF7587 | 430 | 496 | 0.096 | 13.6 |
| TkA07G415550 | PF00665 | rve | 456 | 480 | 4.6e-07 | 30.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q94HW2 | Arabidopsis thaliana | sp|Q94HW2|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1 | 35.100% | Swiss-Prot | Medium |
Q9ZT94 | Arabidopsis thaliana | sp|Q9ZT94|POLR2_ARATH Retrovirus-related Pol polyprotein from transposon RE2 | 32.100% | Swiss-Prot | Low |
P92519 | Arabidopsis thaliana | sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 | 30.400% | Swiss-Prot | Low |