TkA07G414170 | RubberDandelionOmics

Gene overview

TkA07G414170

Reference: TK1151 Chr: Chr07 Coordinates: 104653587-104656575 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1303 bp · TkA07G414170|TK1151|cDNA

AAGAAGTTGAGCATTGTGGAAAGTCTGTCACTTGGTGAAGTTCGTTTAACCACCACCTGTCCAGTTCAGCTCACTCACAAATCTAACGCCGCTTTCCCCTCGTTCATATCGCCATTGATTTTAACTCGACTCTCCTTCATTCTCTCTTTCGCCGCCCTCAAACCCTTACAAAATCCCTACAGATTTCCTCCGCCATTGTCTCCCTTTGATTCGATCTGAATCTATACACCTCCTACACTTGAAATTAGCATCAATGGCGT...

CDS

Download CDS FASTA

852 bp · TkA07G414170|TK1151|CDS

ATGGCGTCGTTCACTGTTCCTTCGCCCAAGACATCGGCTTTGTTCGCGGTTCAACCAAATCACAAGCAGAATCCTAGTCCCAAGCACCGCAACAACTCCGTTGCTCTTTTCCAGTCGGATGTGAAATCCAGCTGTGCATTGATTGCTGGATCATCTTCGCGAGGATTTCAGACATCAAAGAAGAACCAGAAAGATGGCATTAGAGTATCTGCTCAGCTTAATAAGGTTGTTGCTCTTCAGAAAACAAACTCATCACCACC...

Protein

Download Protein FASTA

283 aa · TkA07G414170|TK1151|PROTEIN

MASFTVPSPKTSALFAVQPNHKQNPSPKHRNNSVALFQSDVKSSCALIAGSSSRGFQTSKKNQKDGIRVSAQLNKVVALQKTNSSPPSSEKSKNTTTQSEPTIPVPDDATITAFMNQVAELVQLVDSRDIVELELKQQGCEVVIRKKEALAPPPSSPMVMMQSPQPQAMYQSIPPPPQAAAPSSGPAPSASPPPPPSTPSKPKSSHPPLKSPMAGTFYRAPAPGAPSFVKVGDKVKKGQVICIIEAMKLMNEIEADQDGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G414170`
TK1151 ID	TkA07G414170
OH-1004 ID	LXL04_030594
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G414170

Location Chr07:104653587-104656575 (-)

Description Similar to BCCP1: Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16390`	This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.	No verified direct reference in this release
`At5g15530`	This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030594 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009317 acetyl-CoA carboxylase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003989 acetyl-CoA carboxylase activity Molecular Function

GO:0009374 biotin binding Molecular Function

KEGG gene cross-reference

ana:all5057

ath:AT5G15530

ath:AT5G16390

gmx:548072

sfl:SF3293

sfx:S3510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · TkA07G414170 · TK1151

Mitochondrion0.029

Rank 2 · TkA07G414170 · TK1151

Nucleus0.020

Rank 3 · TkA07G414170 · TK1151

Cytoplasm0.018

Rank 4 · TkA07G414170 · TK1151

Cell membrane0.010

Rank 5 · TkA07G414170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07831PYNP_C60-77 aa

PF26018BSH_RND_rel64-84 aa

PF25984BSH_YknX91-103 aa

PF13375RnfC_N95-117 aa

PF01597GCV_H128-144 aa

PF25973BSH_CzcB205-216 aa

PF00364Biotin_lipoyl209-281 aa

PF26018BSH_RND_rel219-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G414170	`PF07831`	PYNP_C	60	77	0.17	12.3
TkA07G414170	`PF26018`	BSH_RND_rel	64	84	0.015	15.9
TkA07G414170	`PF25984`	BSH_YknX	91	103	0.0014	19.1
TkA07G414170	`PF13375`	RnfC_N	95	117	0.00012	22.8
TkA07G414170	`PF01597`	GCV_H	128	144	0.0022	18.6
TkA07G414170	`PF25973`	BSH_CzcB	205	216	0.0098	16.5
TkA07G414170	`PF00364`	Biotin_lipoyl	209	281	4.4e-25	88.0
TkA07G414170	`PF26018`	BSH_RND_rel	219	261	0.015	15.9
TkA07G414170	`PF13375`	RnfC_N	227	282	0.00012	22.8
TkA07G414170	`PF25984`	BSH_YknX	228	271	0.0014	19.1
TkA07G414170	`PF07831`	PYNP_C	228	244	0.17	12.3
TkA07G414170	`PF06898`	YqfD	228	245	1.0	8.8
TkA07G414170	`PF25997`	BSH_YhbJ	229	271	0.023	15.5
TkA07G414170	`PF01597`	GCV_H	230	264	0.0022	18.6
TkA07G414170	`PF25973`	BSH_CzcB	230	249	0.0098	16.5
TkA07G414170	`PF06898`	YqfD	250	272	1.0	8.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42533`	Arabidopsis thaliana	sp\|Q42533\|BCCP1_ARATH Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic	55.700%	Swiss-Prot	High
`Q9LLC1`	Arabidopsis thaliana	sp\|Q9LLC1\|BCCP2_ARATH Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic	68.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card