TkA07G413770 | RubberDandelionOmics

Gene overview

TkA07G413770

Reference: TK1151 Chr: Chr07 Coordinates: 104536945-104539054 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1873 bp · TkA07G413770|TK1151|cDNA

GATACCCACTCCCGTTCCTTTTTTCTAAATTTGGACCATAACTAAGAAAATAGAGGTTGTTTGATAAAAAATGCAGATCGGATATTGTCTAGGGACTAATATCGTAACTTACTAAAATAGCAAGTATAAATACCAGGGCCGTGTAAATAAAACGTTGTTACTCGTGGCCACTGTAGCCGGAGCTGAACGGAAGATCAAAACTCGTTAAAACCGTCGGAGACTCAGAAAGTTTCTAACCGATGGCTTCGTCGGAGAAGCGG...

CDS

Download CDS FASTA

1575 bp · TkA07G413770|TK1151|CDS

ATGGCTTCGTCGGAGAAGCGGTGTCTGTATGAAGTCCTTGGTGTCCACCGCGACTGTACCGCTGATGAGATCCGATCGGCGTACAGAAAGCTCGCCCTCCAGCGCCACCCAGACAAACTCGTAAAGTCCGGCGTCTCTGAATCCGAAGCAACCGCCTCATTTCAGGAGCTTGTCAACGCTTACGAAGTTCTCTCCGACGCGAAAGAGCGTGCGTGGTACGATTCTCACCGCTCTCAAATCCTCTTCTCCAGTTCAAACGC...

Protein

Download Protein FASTA

524 aa · TkA07G413770|TK1151|PROTEIN

MASSEKRCLYEVLGVHRDCTADEIRSAYRKLALQRHPDKLVKSGVSESEATASFQELVNAYEVLSDAKERAWYDSHRSQILFSSSNANNSSPAIVPDLFNFFSNSVFSGYSDKGTGFYKVYSDVFDKIYRNELNFAKKLGLGDVVKEAPLMGNLDSPYAQVNAFYGFWLGFATVMDFAWADQYDVMAGPNRKSRRLMEEENKKTRKKARREYNDTVRGLAEFVKKRDKRVIDMQVKRNEEIKKKHEEERARKKEIEREKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G413770`
TK1151 ID	TkA07G413770
OH-1004 ID	LXL04_015275
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.500
Protein coverage (%)	TK1151 43.130 / OH-1004 49.672 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G413770

Location Chr07:104536945-104539054 (+)

Description Similar to JJJ1: DNAJ protein JJJ1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74250`	DNAJ protein JJJ1 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015275 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G74250

bta:509302

dre:336984

hsa:134218

mmu:78244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.714

Rank 1 · TkA07G413770 · TK1151

Cytoplasm0.306

Rank 2 · TkA07G413770 · TK1151

Cell membrane0.038

Rank 3 · TkA07G413770 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA07G413770 · TK1151

Mitochondrion0.030

Rank 5 · TkA07G413770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30912TIM141_C6-39 aa

PF00226DnaJ9-74 aa

PF21884ZUO1-like_ZHD117-230 aa

PF16278zf-C2HE275-311 aa

PF28088HVO_2901283-303 aa

PF12756zf-C2H2_2284-319 aa

PF26408DUF8106290-315 aa

PF13248Zn_ribbon_3292-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G413770	`PF30912`	TIM141_C	6	39	0.034	14.9
TkA07G413770	`PF00226`	DnaJ	9	74	6.6e-22	78.1
TkA07G413770	`PF21884`	ZUO1-like_ZHD	117	230	4e-22	79.5
TkA07G413770	`PF16278`	zf-C2HE	275	311	0.075	14.1
TkA07G413770	`PF28088`	HVO_2901	283	303	0.003	18.3
TkA07G413770	`PF12756`	zf-C2H2_2	284	319	1.5e-07	32.3
TkA07G413770	`PF26408`	DUF8106	290	315	0.0044	17.5
TkA07G413770	`PF13248`	Zn_ribbon_3	292	305	0.32	11.3
TkA07G413770	`PF12171`	zf-C2H2_jaz	293	318	1.3e-12	48.2
TkA07G413770	`PF12874`	zf-met	293	317	3.2e-07	31.1
TkA07G413770	`PF10013`	DUF2256	293	310	0.056	14.3
TkA07G413770	`PF13894`	zf-C2H2_4	294	314	4.7e-05	24.5
TkA07G413770	`PF00096`	zf-C2H2	294	317	0.0011	20.0
TkA07G413770	`PF09723`	Zn_ribbon_8	294	303	1.0	10.2
TkA07G413770	`PF25095`	C2H2-zf_KIN17	294	319	2.6	9.1
TkA07G413770	`PF23102`	Zf-C2H2_ZNF451_2nd	295	317	0.031	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C911`	Arabidopsis thaliana	sp\|Q9C911\|JJJ1_ARATH DNAJ protein JJJ1 homolog	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card