TkA07G413700 | RubberDandelionOmics

Gene overview

TkA07G413700

Reference: TK1151 Chr: Chr07 Coordinates: 104507913-104512004 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1995 bp · TkA07G413700|TK1151|cDNA

TGCCATTCATATTCCTTCAATATTTTTTCCCCAGCAAATCACTAAACTCATATTCAAGATAAGTCTCCCTAATAATGGTATTACTATGCAAAAACATGATATGTATATGTCTTTGTGCTAGATTTCCTGGACCACCACCTTCATTTGAATCGAAATAAAACGCCTTTGCCCACCACCGTCCGTCACCACCAACAACGTCAATCGTCACCACCTACTGCTATACTACTATTGTTTGCAGCCTATGGTTTTTTGAGATGTTT...

CDS

Download CDS FASTA

1533 bp · TkA07G413700|TK1151|CDS

ATGAATCTTTGCTCTGTCTCTCATCTCTTCTTCTTTGTCCTCTGCCTTCGATCCACAACAAAACCCTTAAAAGATCCCACTTTCATACAAAAAGCTCCATTATTTCTTCTTTCTCTGTCTCCCTCTAATCAGATGGCAACCCAGGCAGCAAATCCTGCTGCGATTCTTCCAAGTGCTCAAGTCGTTGGCAATGCATTCGTGGAACAGTACTACCATATTCTTCATCAATCTCCTGAATTGGTTCATAAATTCTATCAGGA...

Protein

Download Protein FASTA

510 aa · TkA07G413700|TK1151|PROTEIN

MNLCSVSHLFFFVLCLRSTTKPLKDPTFIQKAPLFLLSLSPSNQMATQAANPAAILPSAQVVGNAFVEQYYHILHQSPELVHKFYQDSSILSRPDMNGLMSSVTTMQAIDEKIQSLDYKNYKAEIETADAQDSYQSGVIVLVTGTLTGTDNIKRKFAQTFFLAPQEKGYFVQSDVFRYVEETASLVTTSGPDNLVIPNSDNNPAMNSEPNNGPEVCDPDDNQESESGLEEQPEPEPESEPVQTRLNETSTLQKPDLSSPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G413700`
TK1151 ID	TkA07G413700
OH-1004 ID	LXL04_030585
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 99.804 / OH-1004 98.646 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G413700

Location Chr07:104507913-104512004 (+)

Description Similar to NTF2: Nuclear transport factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60980`	Involved in RNA-directed DNA methylation (RdDM).	AtMBD6, a methyl CpG binding domain protein, maintains gene silencing in Arabidopsis by interacting with RNA binding proteins.2017 · DOI: 10.1007/s12038-016-9658-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0034063 stress granule assembly Biological Process

GO:0045087 innate immune response Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:1990861 Ubp3-Bre5 deubiquitination complex Cellular Component

KEGG gene cross-reference

ath:AT5G60980

hsa:9908

mmu:23881

pon:100172655

spo:2541364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.638

Rank 1 · TkA07G413700 · TK1151

Nucleus0.368

Rank 2 · TkA07G413700 · TK1151

Cell membrane0.091

Rank 3 · TkA07G413700 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA07G413700 · TK1151

Golgi apparatus0.055

Rank 5 · TkA07G413700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02136NTF262-178 aa

PF22602NXF_NTF264-92 aa

PF02759RUN67-105 aa

PF04124Dor1105-135 aa

PF22969Ig_NUP210_2nd115-161 aa

PF22602NXF_NTF2136-175 aa

PF05887Trypan_PARP196-241 aa

PF05887Trypan_PARP290-322 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G413700	`PF02136`	NTF2	62	178	1.7e-35	122.7
TkA07G413700	`PF22602`	NXF_NTF2	64	92	0.033	15.0
TkA07G413700	`PF02759`	RUN	67	105	0.1	13.5
TkA07G413700	`PF04124`	Dor1	105	135	0.16	11.5
TkA07G413700	`PF22969`	Ig_NUP210_2nd	115	161	0.2	12.2
TkA07G413700	`PF22602`	NXF_NTF2	136	175	0.033	15.0
TkA07G413700	`PF05887`	Trypan_PARP	196	241	0.13	12.9
TkA07G413700	`PF05887`	Trypan_PARP	290	322	0.13	12.9
TkA07G413700	`PF00076`	RRM_1	335	403	9.9e-13	48.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FME2`	Arabidopsis thaliana	sp\|Q9FME2\|NTF2_ARATH Nuclear transport factor 2	46.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card