TkA07G410830 | RubberDandelionOmics

Gene overview

TkA07G410830

Reference: TK1151 Chr: Chr07 Coordinates: 103764408-103765733 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1296 bp · TkA07G410830|TK1151|cDNA

ATGAAGCTCTCAACACATTTACTTGTCTATCCTTTCCCTACCTCCGGCCATATCATCCCCTTACTCGACCTCACCGACCTCCTCCTCCGCCGTGGCCTAACCATCACCGTCATCATCTCCCCCGCCAACCTCCCACTACTCGACCCTCTCCTCTCCTCCCACCCCTCTTCCCTCCACAAGCTTCTCTTCTCCGATCCAGAAATCACCCCATTCCCCGATCCCCTTATCGCCAAAGTACTCTCCACACAAAAACTCTTCGA...

CDS

Download CDS FASTA

1296 bp · TkA07G410830|TK1151|CDS

ATGAAGCTCTCAACACATTTACTTGTCTATCCTTTCCCTACCTCCGGCCATATCATCCCCTTACTCGACCTCACCGACCTCCTCCTCCGCCGTGGCCTAACCATCACCGTCATCATCTCCCCCGCCAACCTCCCACTACTCGACCCTCTCCTCTCCTCCCACCCCTCTTCCCTCCACAAGCTTCTCTTCTCCGATCCAGAAATCACCCCATTCCCCGATCCCCTTATCGCCAAAGTACTCTCCACACAAAAACTCTTCGA...

Protein

Download Protein FASTA

431 aa · TkA07G410830|TK1151|PROTEIN

MKLSTHLLVYPFPTSGHIIPLLDLTDLLLRRGLTITVIISPANLPLLDPLLSSHPSSLHKLLFSDPEITPFPDPLIAKVLSTQKLFDPIVKWFRSHPSPPVAILSDFFLGWTTELASHLGIRRVVFSTSGVLSFSILQTLWEDVEEINADNGDQRDEKLSISFPWQLLPVSCNFKKGEPNYESFRNGMLGNMNSWGIVYNTFEDLESVYIDHMKKQMGHDRVWAVGPLLPNEHSLLSTMTRGGSGIVPPNDLLKWLDKKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410830`
TK1151 ID	TkA07G410830
OH-1004 ID	LXL04_030555
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 99.304 / OH-1004 96.264 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G410830

Location Chr07:103764408-103765733 (-)

Description Similar to UGT89B2: UDP-glycosyltransferase 89B2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73880`	Possesses quercetin 3-O-glucosyltransferase, 7-O-glucosyltransferase and 4'-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At5g03490`	Glucosyltransferase that glucosylates benzoates and benzoate derivatives in vitro.	No verified direct reference in this release
`At1g06000`	May catalyze rhamnosyl transfer to flavonols.	Identification of a flavonol 7-O-rhamnosyltransferase gene determining flavonoid pattern in Arabidopsis by transcriptome coexpression analysis and reverse genetics.2007 · DOI: 10.1074/jbc.m611498200 Regioselective synthesis of flavonoid bisglycosides using Escherichia coli harboring two glycosyltransferases.2013 · DOI: 10.1007/s00253-013-4844-7 Expanded acceptor substrates flexibility study of flavonol 7-O-rhamnosyltransferase, AtUGT89C1 from Arabidopsis thaliana.2015 · DOI: 10.1016/j.carres.2015.09.010 7-Rhamnosylated Flavonols Modulate Homeostasis of the Plant Hormone Auxin and Affect Plant Development.2016 · DOI: 10.1074/jbc.m115.701565 Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-β-l-rhamnose and rhamnosylation mechanism.2019 · DOI: 10.1111/tpj.14321

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030555 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:1901734 quercetin biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06000

ath:AT1G73880

ath:AT2G36780

ath:AT5G03490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.799

Rank 1 · TkA07G410830 · TK1151

Nucleus0.251

Rank 2 · TkA07G410830 · TK1151

Peroxisome0.061

Rank 3 · TkA07G410830 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA07G410830 · TK1151

Plastid0.052

Rank 5 · TkA07G410830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT7-44 aa

PF26168Glyco_transf_N8-37 aa

PF26168Glyco_transf_N181-230 aa

PF00201UDPGT256-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410830	`PF00201`	UDPGT	7	44	3.7e-13	49.8
TkA07G410830	`PF26168`	Glyco_transf_N	8	37	1e-08	36.1
TkA07G410830	`PF26168`	Glyco_transf_N	181	230	1e-08	36.1
TkA07G410830	`PF00201`	UDPGT	256	372	3.7e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9B0`	Arabidopsis thaliana	sp\|Q9C9B0\|U89B1_ARATH Flavonol 3-O-glucosyltransferase UGT89B1	45.400%	Swiss-Prot	Medium
`Q9LZD8`	Arabidopsis thaliana	sp\|Q9LZD8\|U89A2_ARATH UDP-glycosyltransferase 89A2	43.400%	Swiss-Prot	Medium
`Q9LNE6`	Arabidopsis thaliana	sp\|Q9LNE6\|U89C1_ARATH Flavonol 7-O-rhamnosyltransferase	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card