TkA07G410800 | RubberDandelionOmics

Gene overview

TkA07G410800

Reference: TK1151 Chr: Chr07 Coordinates: 103741499-103742227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA07G410800|TK1151|cDNA

GTAACAATCATTCTCTTTCTCTTTGAAGAGCTTATTATGTGAATAAGCTTCTAGAGCATACTAGATAATTTCCACCTGTGTCACATGGCATATAAAGCACTTCTTTTCTTCAAGGCATCCCTTCCAGAGGTGACACCTGGCAGCTACTCAAACACTACTGTGGATTGGTCGAGAGTATACGAATTCTCTTTTCTACCCTTTCATAATGGAAATCTAATAGAGGAAGTAGTTGGAAGCAGTTCGAACTCAACTACCTTATC...

CDS

Download CDS FASTA

396 bp · TkA07G410800|TK1151|CDS

ATGGCATATAAAGCACTTCTTTTCTTCAAGGCATCCCTTCCAGAGGTGACACCTGGCAGCTACTCAAACACTACTGTGGATTGGTCGAGAGTATACGAATTCTCTTTTCTACCCTTTCATAATGGAAATCTAATAGAGGAAGTAGTTGGAAGCAGTTCGAACTCAACTACCTTATCGTTAGAAGGGAAACGACAACCAGATGATGAATTAAAGAATACTAAGTCGTTTAAATATACTCCTATGAGCCGCCAAGATAGAGT...

Protein

Download Protein FASTA

131 aa · TkA07G410800|TK1151|PROTEIN

MAYKALLFFKASLPEVTPGSYSNTTVDWSRVYEFSFLPFHNGNLIEEVVGSSSNSTTLSLEGKRQPDDELKNTKSFKYTPMSRQDRVLRYFEKKKTRKYEKKLIKYSSRKTYAQTRPRIRGRFARRSQVDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410800`
TK1151 ID	TkA07G410800
OH-1004 ID	LXL04_030550
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 48.162 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G410800

Location Chr07:103741499-103742227 (-)

Description Similar to COL2: Zinc finger protein CONSTANS-LIKE 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02380`	Putative transcription factor.	No verified direct reference in this release
`At5g15850`	Putative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time.	No verified direct reference in this release
`At5g15840`	Transcription factor that acts in the long day flowering pathway and may mediate between the circadian clock and the control of flowering.	No verified direct reference in this release
`At2g24790`	Zinc finger protein CONSTANS-LIKE 3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0275000`	Probable transcription factor involved in the regulation of flower development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030550 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010161 red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048571 long-day photoperiodism Biological Process

KEGG gene cross-reference

ath:AT2G24790

ath:AT3G02380

ath:AT5G15840

ath:AT5G15850

dosa:Os06g0275000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.793

Rank 1 · TkA07G410800 · TK1151

Cytoplasm0.266

Rank 2 · TkA07G410800 · TK1151

Mitochondrion0.035

Rank 3 · TkA07G410800 · TK1151

Cell membrane0.035

Rank 4 · TkA07G410800 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA07G410800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06242TrcR38-86 aa

PF08703PLC-beta_C67-116 aa

PF06203CCT83-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410800	`PF06242`	TrcR	38	86	0.13	13.0
TkA07G410800	`PF08703`	PLC-beta_C	67	116	0.031	14.5
TkA07G410800	`PF06203`	CCT	83	126	3.6e-14	53.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96502`	Arabidopsis thaliana	sp\|Q96502\|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2	63.500%	Swiss-Prot	Low
`O50055`	Arabidopsis thaliana	sp\|O50055\|COL1_ARATH Zinc finger protein CONSTANS-LIKE 1	62.300%	Swiss-Prot	Low
`Q39057`	Arabidopsis thaliana	sp\|Q39057\|CONS_ARATH Zinc finger protein CONSTANS	54.000%	Swiss-Prot	Low
`Q9SK53`	Arabidopsis thaliana	sp\|Q9SK53\|COL3_ARATH Zinc finger protein CONSTANS-LIKE 3	52.300%	Swiss-Prot	Low
`Q9FDX8`	Oryza sativa subsp. japonica	sp\|Q9FDX8\|HD1_ORYSJ Zinc finger protein HD1	60.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card