TkA07G410380 | RubberDandelionOmics

Gene overview

TkA07G410380

Reference: TK1151 Chr: Chr07 Coordinates: 103610496-103610990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA07G410380|TK1151|cDNA

ATGGCCGATAGAACCAACGTCTCCGGCCAACACCAACGACCACCAAGACCCATCACCAGCGGCGATGGAGGACAATTCATCCGTAGACTCCGTCACCACTCCCTCAACTCAACCCAACTCATGGGTATCATGACCCTTGTCATCTCCGGCGCCATCTTACTCCTCCTTACCGGCGTCACCATCACTGTATCCGTTCTCGGATTCATCTTCTTTGCACCCATCATCATCCTCACCAGCCCCATCTGGGTGCCGATCGGCAC...

CDS

Download CDS FASTA

495 bp · TkA07G410380|TK1151|CDS

ATGGCCGATAGAACCAACGTCTCCGGCCAACACCAACGACCACCAAGACCCATCACCAGCGGCGATGGAGGACAATTCATCCGTAGACTCCGTCACCACTCCCTCAACTCAACCCAACTCATGGGTATCATGACCCTTGTCATCTCCGGCGCCATCTTACTCCTCCTTACCGGCGTCACCATCACTGTATCCGTTCTCGGATTCATCTTCTTTGCACCCATCATCATCCTCACCAGCCCCATCTGGGTGCCGATCGGCAC...

Protein

Download Protein FASTA

164 aa · TkA07G410380|TK1151|PROTEIN

MADRTNVSGQHQRPPRPITSGDGGQFIRRLRHHSLNSTQLMGIMTLVISGAILLLLTGVTITVSVLGFIFFAPIIILTSPIWVPIGTLLFVLVAGFISVCGSGLAAAAAVSWLYKYFRGLHPVGSDRVDYARSRIADTASHMKDYAREYGGYFQSKVKDAAPGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410380`
TK1151 ID	TkA07G410380
OH-1004 ID	LXL04_030537
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G410380`
Location	Chr07:103610496-103610990 (+)
Description	Similar to Oleosin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030537` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009791 post-embryonic development Biological Process GO:0010152 pollen maturation Biological Process GO:0010431 seed maturation Biological Process GO:0019915 lipid storage Biological Process GO:0034389 lipid droplet organization Biological Process GO:0048608 reproductive structure development Biological Process GO:0048653 anther development Biological Process GO:0005576 extracellular region Cellular Component GO:0012511 monolayer-surrounded lipid storage body Cellular Component GO:0016020 membrane Cellular Component GO:0019863 IgE binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.391

Rank 1 · TkA07G410380 · TK1151

Cytoplasm0.215

Rank 2 · TkA07G410380 · TK1151

Cell membrane0.194

Rank 3 · TkA07G410380 · TK1151

Nucleus0.181

Rank 4 · TkA07G410380 · TK1151

Golgi apparatus0.148

Rank 5 · TkA07G410380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18949DUF569337-117 aa

PF01277Oleosin38-150 aa

PF26440DUF8108_M40-72 aa

PF07332Phage_holin_3_647-108 aa

PF24126DUF739450-65 aa

PF29806F46C5_756-149 aa

PF11014DUF285258-76 aa

PF26440DUF8108_M85-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410380	`PF18949`	DUF5693	37	117	0.16	11.1
TkA07G410380	`PF01277`	Oleosin	38	150	2.1e-42	144.2
TkA07G410380	`PF26440`	DUF8108_M	40	72	0.074	13.8
TkA07G410380	`PF07332`	Phage_holin_3_6	47	108	8.3	7.2
TkA07G410380	`PF24126`	DUF7394	50	65	0.7	10.9
TkA07G410380	`PF29806`	F46C5_7	56	149	0.2	12.0
TkA07G410380	`PF11014`	DUF2852	58	76	0.19	12.5
TkA07G410380	`PF26440`	DUF8108_M	85	109	0.074	13.8
TkA07G410380	`PF11014`	DUF2852	89	130	0.19	12.5
TkA07G410380	`PF24126`	DUF7394	91	120	0.7	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card