TkA07G410040 | RubberDandelionOmics

Gene overview

TkA07G410040

Reference: TK1151 Chr: Chr07 Coordinates: 103535112-103539218 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1979 bp · TkA07G410040|TK1151|cDNA

GTCATCCATACACCACAGAAAATATTGGCACTCAGACAAGAGTCCCTCACAATCTCACGGCGTTTAAAGCGGAGGCCGGAGAGTTCAAAGCTTCGATCAGTCACATCCATGGCTGCAAATCGTACTTCCGCTTCTTCCAAATCCACAAGTACTCAAAACACTGCCACCCCCACTAAATCGAAGACGAAAAGGAAAGCGAAGCCGAAGCCGAAGCCGATTCAGGATGAGTCAAATCAGCCCCAAACACCCCAGAATAATCA...

CDS

Download CDS FASTA

1695 bp · TkA07G410040|TK1151|CDS

GTCATCCATACACCACAGAAAATATTGGCACTCAGACAAGAGTCCCTCACAATCTCACGGCGTTTAAAGCGGAGGCCGGAGAGTTCAAAGCTTCGATCAGTCACATCCATGGCTGCAAATCGTACTTCCGCTTCTTCCAAATCCACAAGTACTCAAAACACTGCCACCCCCACTAAATCGAAGACGAAAAGGAAAGCGAAGCCGAAGCCGAAGCCGATTCAGGATGAGTCAAATCAGCCCCAAACACCCCAGAATAATCA...

Protein

Download Protein FASTA

564 aa · TkA07G410040|TK1151|PROTEIN

VIHTPQKILALRQESLTISRRLKRRPESSKLRSVTSMAANRTSASSKSTSTQNTATPTKSKTKRKAKPKPKPIQDESNQPQTPQNNQLNPSSSSTPKRTKSPGFRVVGKRIYDSKNGKTCHQCRQKTLDFSVTCTNQGENKKPCPLNVCQACLLNRYGENAEEAAESVDWKCPRCRGICNCSFCMKKRGCGPTGSLALTTKKIGFKSVSSFLDMSGCQVAKTANGGSRKRQNVSDKEPKDEMETNEMKEEVVGESEDEKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G410040`
TK1151 ID	TkA07G410040
OH-1004 ID	LXL04_030534
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 98.582 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G410040`
Location	Chr07:103535112-103539218 (+)
Description	Similar to CDCA7L: Cell division cycle-associated 7-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030534` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0001650 fibrillar center Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	bta:614893 hsa:55536 hsa:83879 rno:619566 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA07G410040 · TK1151

Cytoplasm0.084

Rank 2 · TkA07G410040 · TK1151

Cell membrane0.022

Rank 3 · TkA07G410040 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA07G410040 · TK1151

Plastid0.010

Rank 5 · TkA07G410040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10497zf-4CXXC_R1112-212 aa

PF02791DDT292-351 aa

PF15612WHIM1387-414 aa

PF23311DUF7084445-468 aa

PF23311DUF7084474-485 aa

PF15612WHIM1549-564 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G410040	`PF10497`	zf-4CXXC_R1	112	212	5.1e-34	117.1
TkA07G410040	`PF02791`	DDT	292	351	0.019	15.8
TkA07G410040	`PF15612`	WHIM1	387	414	0.004	17.4
TkA07G410040	`PF23311`	DUF7084	445	468	0.15	12.6
TkA07G410040	`PF23311`	DUF7084	474	485	0.15	12.6
TkA07G410040	`PF15612`	WHIM1	549	564	0.004	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card