TkA07G409950 | RubberDandelionOmics

Gene overview

TkA07G409950

Reference: TK1151 Chr: Chr07 Coordinates: 103502498-103503671 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

893 bp · TkA07G409950|TK1151|cDNA

TAACATTTTTCATATCTAAGCTCAATTTTGAAAGAATAAAAAAATTACTACTACTCAATTTTGTAGTGAAATCAGCCGAATCAAAACGACAGCCAAGGCAACTAGAACTCTAGAAGTAGTTGATTTCAAAATCAAAGCTCCGAAATGGATCGCAAGGAAAATCAATATTCTCAAAGGGAACTAGTTGAATTTCTCCAAATTGCCATTACATCCATCATTTTCCTCAAAGGAATCTACCCTCCCGGTGCTTTTGAAAGGCG...

CDS

Download CDS FASTA

582 bp · TkA07G409950|TK1151|CDS

ATGGATCGCAAGGAAAATCAATATTCTCAAAGGGAACTAGTTGAATTTCTCCAAATTGCCATTACATCCATCATTTTCCTCAAAGGAATCTACCCTCCCGGTGCTTTTGAAAGGCGGCGATTCATGAATTTGTTAGTTCACAAGGCTCGCCACCCTCAGCTTAACCGCTACATCCACGACGCCGTCAATGCCCTTGTTCCTTACATCCAACAGGGGTTGGTTGAGAGAATTGCAGTTATATTCTTCAAGGATGATAGAAT...

Protein

Download Protein FASTA

193 aa · TkA07G409950|TK1151|PROTEIN

MDRKENQYSQRELVEFLQIAITSIIFLKGIYPPGAFERRRFMNLLVHKARHPQLNRYIHDAVNALVPYIQQGLVERIAVIFFKDDRIPVERFIFKINANVNQSCDDGGENAMMDMRSFLMKLSLSEPISAVVSQDWKWEITGYFSSVPESEDGVWISSNAQQWTQPPLITPIKSMNIQPLSLQLYLEHPPPNH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G409950`
TK1151 ID	TkA07G409950
OH-1004 ID	LXL04_030530
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G409950

Location Chr07:103502498-103503671 (-)

Description Similar to REV7: DNA polymerase zeta processivity subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16590`	Regulatory subunit of the error prone DNA polymerase zeta.	Roles of Arabidopsis AtREV1 and AtREV7 in translesion synthesis.2005 · DOI: 10.1104/pp.105.060236

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0001558 regulation of cell growth Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007015 actin filament organization Biological Process

GO:0009794 regulation of mitotic cell cycle, embryonic Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010944 negative regulation of transcription by competitive promoter binding Biological Process

GO:0019985 translesion synthesis Biological Process

KEGG gene cross-reference

ath:AT1G16590

bta:506605

rno:313702

xla:394380

xtr:448122

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.685

Rank 1 · TkA07G409950 · TK1151

Cytoplasm0.482

Rank 2 · TkA07G409950 · TK1151

Lysosome / Vacuole0.034

Rank 3 · TkA07G409950 · TK1151

Mitochondrion0.033

Rank 4 · TkA07G409950 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA07G409950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02301HORMA14-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G409950	`PF02301`	HORMA	14	126	3.9e-09	37.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94FL5`	Arabidopsis thaliana	sp\|Q94FL5\|REV7_ARATH DNA polymerase zeta processivity subunit	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card