TkA07G406670 | RubberDandelionOmics

Gene overview

TkA07G406670

Reference: TK1151 Chr: Chr07 Coordinates: 102231986-102232492 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · TkA07G406670|TK1151|cDNA

ATGGATACACTAACACCGAAATTTAATTTAAAAAAAGTATCGTTACCACAAGTAATTAAATCAAAAGCGGGGACTGTATCATACGAGCTGAATGTTCTACGCACAAAAGGGCCAAGAAGAATGAATTGCACAATGCACTTGATCCCCATCTCCTTTGCCGCCGTGCAACCGGCGGCCCGCCCCAACTCCGGCGACATTTCCCGATCAACCGTGAAGAAAACACGATACGCCGTGGTGGTTGTTGAGAGGAAGGACGCGTT...

CDS

Download CDS FASTA

507 bp · TkA07G406670|TK1151|CDS

ATGGATACACTAACACCGAAATTTAATTTAAAAAAAGTATCGTTACCACAAGTAATTAAATCAAAAGCGGGGACTGTATCATACGAGCTGAATGTTCTACGCACAAAAGGGCCAAGAAGAATGAATTGCACAATGCACTTGATCCCCATCTCCTTTGCCGCCGTGCAACCGGCGGCCCGCCCCAACTCCGGCGACATTTCCCGATCAACCGTGAAGAAAACACGATACGCCGTGGTGGTTGTTGAGAGGAAGGACGCGTT...

Protein

Download Protein FASTA

168 aa · TkA07G406670|TK1151|PROTEIN

MDTLTPKFNLKKVSLPQVIKSKAGTVSYELNVLRTKGPRRMNCTMHLIPISFAAVQPAARPNSGDISRSTVKKTRYAVVVVERKDALVLRNKAPRGWHEQLQCWCLNFRGRVTVASVKNFQLAVGGGVVVVVVWSRMMWCCSLGRLGRIFSRWITGTHYRLFRRLRYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G406670`
TK1151 ID	TkA07G406670
OH-1004 ID	LXL04_024593
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.000
Protein coverage (%)	TK1151 69.048 / OH-1004 30.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G406670

Location Chr07:102231986-102232492 (-)

Description Similar to TULP5: Tubby-like F-box protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18280`	Tubby-like F-box protein 2.	No verified direct reference in this release
`At1g47270`	Tubby-like F-box protein 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0351400`	Tubby-like F-box protein 6.	No verified direct reference in this release
`Os02g0705300`	Tubby-like F-box protein 5.	No verified direct reference in this release
`Os12g0163400`	Tubby-like F-box protein 14.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024593 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009620 response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G47270

ath:AT2G18280

dosa:Os02g0705300

dosa:Os03g0351400

dosa:Os12g0163400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.355

Rank 1 · TkA07G406670 · TK1151

Nucleus0.320

Rank 2 · TkA07G406670 · TK1151

Mitochondrion0.250

Rank 3 · TkA07G406670 · TK1151

Cell membrane0.095

Rank 4 · TkA07G406670 · TK1151

Endoplasmic reticulum0.070

Rank 5 · TkA07G406670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01167Tub8-124 aa

PF07204Orthoreo_P10121-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G406670	`PF01167`	Tub	8	124	1.1e-30	108.0
TkA07G406670	`PF07204`	Orthoreo_P10	121	143	0.069	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GVE5`	Arabidopsis thaliana	sp\|Q8GVE5\|TLP2_ARATH Tubby-like F-box protein 2	52.300%	Swiss-Prot	Medium
`Q0WPY0`	Arabidopsis thaliana	sp\|Q0WPY0\|TLP6_ARATH Tubby-like F-box protein 6	53.200%	Swiss-Prot	Medium
`Q10LG8`	Oryza sativa subsp. japonica	sp\|Q10LG8\|TLP6_ORYSJ Tubby-like F-box protein 6	54.000%	Swiss-Prot	Medium
`Q6Z2G9`	Oryza sativa subsp. japonica	sp\|Q6Z2G9\|TLP5_ORYSJ Tubby-like F-box protein 5	52.100%	Swiss-Prot	Medium
`Q2QXB2`	Oryza sativa subsp. japonica	sp\|Q2QXB2\|TLP14_ORYSJ Tubby-like F-box protein 14	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card