TkA07G403550 | RubberDandelionOmics

Gene overview

TkA07G403550

Reference: TK1151 Chr: Chr07 Coordinates: 101413405-101414529 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · TkA07G403550|TK1151|cDNA

ATGGAAAAAACCCACAAAGGGAGCAAAAACATTTTTAATGGCACGAAATCAAACTTATCATTCAACAAAGGAGAACTCATAAATGCACAGACGAAACTAAAGCAGGCTTTCGTAGAGTTTCACCGAAAGCTCCAACTTCTGAAAAACTACTCTTTCTTGAATCAATTAGCTTTCTCCAAGATCTTGAAGAAGTACGATAAGATAACATCAAGAAACACATCAAAAGGTTATCTGGAGATGGTTGAAAATTCTTATTTGGG...

CDS

Download CDS FASTA

549 bp · TkA07G403550|TK1151|CDS

ATGGAAAAAACCCACAAAGGGAGCAAAAACATTTTTAATGGCACGAAATCAAACTTATCATTCAACAAAGGAGAACTCATAAATGCACAGACGAAACTAAAGCAGGCTTTCGTAGAGTTTCACCGAAAGCTCCAACTTCTGAAAAACTACTCTTTCTTGAATCAATTAGCTTTCTCCAAGATCTTGAAGAAGTACGATAAGATAACATCAAGAAACACATCAAAAGGTTATCTGGAGATGGTTGAAAATTCTTATTTGGG...

Protein

Download Protein FASTA

182 aa · TkA07G403550|TK1151|PROTEIN

MEKTHKGSKNIFNGTKSNLSFNKGELINAQTKLKQAFVEFHRKLQLLKNYSFLNQLAFSKILKKYDKITSRNTSKGYLEMVENSYLGQSDEVVKLMERVEAAFIKHFANANHRQGMRDLRPSAKRDKHRLTFFIDELEISEKLLGIKGGYHGTLVVLKKKATGEIIVEGRHSLFSKPTTNYM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G403550`
TK1151 ID	TkA07G403550
OH-1004 ID	LXL04_030445
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.700
Protein coverage (%)	TK1151 95.604 / OH-1004 85.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G403550

Location Chr07:101413405-101414529 (+)

Description Similar to PHO1-H2: Phosphate transporter PHO1 homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03240`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`At2g03260`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`At3g29060`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`At1g14040`	May transport inorganic phosphate (Pi).	No verified direct reference in this release
`At2g03250`	May transport inorganic phosphate (Pi).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030445 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006817 phosphate ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000822 inositol hexakisphosphate binding Molecular Function

GO:0005315 phosphate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G14040

ath:AT1G26730

ath:AT2G03240

ath:AT2G03260

ath:AT3G29060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.486

Rank 1 · TkA07G403550 · TK1151

Cytoplasm0.296

Rank 2 · TkA07G403550 · TK1151

Endoplasmic reticulum0.188

Rank 3 · TkA07G403550 · TK1151

Nucleus0.125

Rank 4 · TkA07G403550 · TK1151

Golgi apparatus0.101

Rank 5 · TkA07G403550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03105SPX14-81 aa

PF25876HH_MFP_RND22-48 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G403550	`PF03105`	SPX	14	81	9.8e-23	82.4
TkA07G403550	`PF25876`	HH_MFP_RND	22	48	0.11	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6R8G5`	Arabidopsis thaliana	sp\|Q6R8G5\|PHO15_ARATH Phosphate transporter PHO1 homolog 5	65.800%	Swiss-Prot	Medium
`Q6R8G8`	Arabidopsis thaliana	sp\|Q6R8G8\|PHO12_ARATH Phosphate transporter PHO1 homolog 2	63.200%	Swiss-Prot	Medium
`Q9LJW0`	Arabidopsis thaliana	sp\|Q9LJW0\|PHO19_ARATH Phosphate transporter PHO1 homolog 9	62.800%	Swiss-Prot	Medium
`Q6R8G7`	Arabidopsis thaliana	sp\|Q6R8G7\|PHO13_ARATH Phosphate transporter PHO1 homolog 3	62.900%	Swiss-Prot	Medium
`Q6R8G4`	Arabidopsis thaliana	sp\|Q6R8G4\|PHO16_ARATH Phosphate transporter PHO1 homolog 6	62.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card