TkA07G402910 | RubberDandelionOmics

Gene overview

TkA07G402910

Reference: TK1151 Chr: Chr07 Coordinates: 101251525-101252444 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · TkA07G402910|TK1151|cDNA

GTCATTGCTGATGCTACTACATTGACTCAGGCAGGTTATGTTGGAGAAGATGTGGAATCAATATTGTATAAGCTCCTTGTGGCTGCTGACTTTAATGTGGAAGCAGCTCAACAAGGGATTGTGTACATAGATGAAGTTGATAAGATAACTAAAAAGGCTGAAAGTTTAAATAGTGGTAGAGATGTATCTGGAGAAGGGGTTCAACAAGCATTGCTCAAAATGCTTGAAGGAACTATTGTAAATGTTCCCGATAATCGATC...

CDS

Download CDS FASTA

459 bp · TkA07G402910|TK1151|CDS

GTCATTGCTGATGCTACTACATTGACTCAGGCAGGTTATGTTGGAGAAGATGTGGAATCAATATTGTATAAGCTCCTTGTGGCTGCTGACTTTAATGTGGAAGCAGCTCAACAAGGGATTGTGTACATAGATGAAGTTGATAAGATAACTAAAAAGGCTGAAAGTTTAAATAGTGGTAGAGATGTATCTGGAGAAGGGGTTCAACAAGCATTGCTCAAAATGCTTGAAGGAACTATTGTAAATGTTCCCGATAATCGATC...

Protein

Download Protein FASTA

153 aa · TkA07G402910|TK1151|PROTEIN

VIADATTLTQAGYVGEDVESILYKLLVAADFNVEAAQQGIVYIDEVDKITKKAESLNSGRDVSGEGVQQALLKMLEGTIVNVPDNRSKKQPQGDGIQVDTKDILFICGGAFVDLEKTICERRQDSSIGFGAPVRANMRGGGLTNAVVTSSLLE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G402910`
TK1151 ID	TkA07G402910
OH-1004 ID	LXL04_029620
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 47.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G402910

Location Chr07:101251525-101252444 (-)

Description Similar to CLPX1: CLP protease regulatory subunit CLPX1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53350`	ATP-dependent specificity component of the mitochondrial Clp protease.	No verified direct reference in this release
`At1g33360`	ATP-dependent specificity component of the mitochondrial Clp protease.	No verified direct reference in this release
`At5g49840`	ATP-dependent specificity component of the mitochondrial Clp protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029620 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009376 HslUV protease complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008233 peptidase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G33360

ath:AT5G49840

ath:AT5G53350

bja:bll4943

msl:Msil_2914

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.608

Rank 1 · TkA07G402910 · TK1151

Nucleus0.468

Rank 2 · TkA07G402910 · TK1151

Mitochondrion0.056

Rank 3 · TkA07G402910 · TK1151

Cell membrane0.047

Rank 4 · TkA07G402910 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA07G402910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07724AAA_22-118 aa

PF00004AAA34-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G402910	`PF07724`	AAA_2	2	118	6.2e-19	69.4
TkA07G402910	`PF00004`	AAA	34	100	8.6e-05	23.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK07`	Arabidopsis thaliana	sp\|Q9FK07\|CLPX1_ARATH CLP protease regulatory subunit CLPX1, mitochondrial	84.300%	Swiss-Prot	High
`Q66GN9`	Arabidopsis thaliana	sp\|Q66GN9\|CLPX3_ARATH CLP protease regulatory subunit CLPX3, mitochondrial	81.700%	Swiss-Prot	High
`F4K7F6`	Arabidopsis thaliana	sp\|F4K7F6\|CLPX2_ARATH CLP protease regulatory subunit CLPX2, mitochondrial	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card