RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G399750
Reference: TK1151 Chr: Chr07 Coordinates: 100426670-100427151 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

369 bp · TkA07G399750|TK1151|cDNA

ATGGTTTCAGGAATCCCTAAATCCGCTCCTCCATTTACCAGCGACACCAACTCCAGTTCCATACCTGCTTTCTTCTCTGTTGTCACCACCAAATCCGCTCACCCCCGATCCTTCAACGGCGCCGATTTCTTAAAATCGAAGCCTTCCCTTTGTGGTTTTCCTTCTCTGCTTCTCCTCCTCCGATCCCGAATACCGCCATCTAGCGGCGTTCCTAATGCGATCTATCACCGATTCCAGCCCGATTCTGTTGATTCCCAATC...

CDS

Download CDS FASTA

369 bp · TkA07G399750|TK1151|CDS

ATGGTTTCAGGAATCCCTAAATCCGCTCCTCCATTTACCAGCGACACCAACTCCAGTTCCATACCTGCTTTCTTCTCTGTTGTCACCACCAAATCCGCTCACCCCCGATCCTTCAACGGCGCCGATTTCTTAAAATCGAAGCCTTCCCTTTGTGGTTTTCCTTCTCTGCTTCTCCTCCTCCGATCCCGAATACCGCCATCTAGCGGCGTTCCTAATGCGATCTATCACCGATTCCAGCCCGATTCTGTTGATTCCCAATC...

Protein

Download Protein FASTA

122 aa · TkA07G399750|TK1151|PROTEIN

MVSGIPKSAPPFTSDTNSSSIPAFFSVVTTKSAHPRSFNGADFLKSKPSLCGFPSLLLLLRSRIPPSSGVPNAIYHRFQPDSVDSQSRFDKKRFDFDFGADSIPTPGIQTSALCLLIQRHFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G399750
TK1151 IDTkA07G399750
OH-1004 IDLXL04_010300
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 54.918 / OH-1004 21.753
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G399750
LocationChr07:100426670-100427151 (-)
DescriptionSimilar to At5g09550: Guanosine nucleotide diphosphate dissociation inhibitor At5g09550
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process
GO:0006893 Golgi to plasma membrane transport Biological Process
GO:0007264 small GTPase-mediated signal transduction Biological Process
GO:0015031 protein transport Biological Process
GO:0016192 vesicle-mediated transport Biological Process
GO:0032482 Rab protein signal transduction Biological Process
GO:0034123 positive regulation of toll-like receptor signaling pathway Biological Process
GO:0034142 toll-like receptor 4 signaling pathway Biological Process
GO:0051592 response to calcium ion Biological Process
GO:0090315 negative regulation of protein targeting to membrane Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference
ath:AT3G59920
ath:AT5G09550
mmu:14567
rno:25183
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.457
Rank 1 · TkA07G399750 · TK1151
Cytoplasm0.426
Rank 2 · TkA07G399750 · TK1151
Cell membrane0.093
Rank 3 · TkA07G399750 · TK1151
Endoplasmic reticulum0.078
Rank 4 · TkA07G399750 · TK1151
Mitochondrion0.076
Rank 5 · TkA07G399750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser