TkA07G397480 | RubberDandelionOmics

Gene overview

TkA07G397480

Reference: TK1151 Chr: Chr07 Coordinates: 99857606-99870861 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1880 bp · TkA07G397480|TK1151|cDNA

TTCCCTTCCTCTTCTTTCTTTTTCACTCCTTCGTCTCCGGCCCTCTTCTCACTCCATCTTCGGCTCTCTTGCACACCAGATCCGACCCAAATCCATATCCGCCTCCGATCACTAAAACAAACCATCGCTGCTTCACGACCTCCATTGCTTCTTCCTCGCTGGTTCACGCCTTCACGCTGCTGTGATTCTTCCGGATGGCGTCTACCTTCCTTGCCGATCTTAAGCCGAAGGATAGAAACAAAATTATTGAAGTTAAAATA...

CDS

Download CDS FASTA

1347 bp · TkA07G397480|TK1151|CDS

ATGGCGTCTACCTTCCTTGCCGATCTTAAGCCGAAGGATAGAAACAAAATTATTGAAGTTAAAATATATCGTACATGGATCGTGAGGTTTCCCCCTAATCCAGCCCCAAAACTGTTCTGTTGTATGTTACTTGATAAAGCGGGAAATGCAATTCAAGCAACTATGTCCATCAACGACATTGAATATTTTAAACCAATTGTTGAGGTGGACAAAGCATACAAGATATCAAACTTTTTTTGTGAAGAAACAAAATCAAAGCA...

Protein

Download Protein FASTA

448 aa · TkA07G397480|TK1151|PROTEIN

MASTFLADLKPKDRNKIIEVKIYRTWIVRFPPNPAPKLFCCMLLDKAGNAIQATMSINDIEYFKPIVEVDKAYKISNFFCEETKSKQHPLPNPTTLRFGRATTFHPIPLHGFPSHHFNFVSYNQLYSTLEKSPILIDYIGCIQNVGPVTRSTDPNKNQVDKRSIDIINLNGNIVEFTMWDKMAMNFDVSSMPKPVMIAVTSCRVQQFQNQLQLSATQATHYYLNPDIEEVNNSLPKYKTMFTATPPLQVVKQKYPDHEKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G397480`
TK1151 ID	TkA07G397480
OH-1004 ID	LXL04_018379
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 22.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G397480`
Location	Chr07:99857606-99870861 (+)
Description	Similar to pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018379` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0034502 protein localization to chromosome Biological Process GO:0051276 chromosome organization Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005662 DNA replication factor A complex Cellular Component
KEGG gene cross-reference	cje:Cj0945c dre:327491 tbr:Tb10.70.7240 xla:734585 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.815

Rank 1 · TkA07G397480 · TK1151

Cytoplasm0.210

Rank 2 · TkA07G397480 · TK1151

Extracellular0.039

Rank 3 · TkA07G397480 · TK1151

Cell membrane0.034

Rank 4 · TkA07G397480 · TK1151

Mitochondrion0.026

Rank 5 · TkA07G397480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02721DUF2238-119 aa

PF16900REPA_OB_243-78 aa

PF16900REPA_OB_2134-222 aa

PF02721DUF223204-244 aa

PF10764Gin285-298 aa

PF10764Gin301-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G397480	`PF02721`	DUF223	8	119	1.6e-05	25.7
TkA07G397480	`PF16900`	REPA_OB_2	43	78	2.4e-12	47.4
TkA07G397480	`PF16900`	REPA_OB_2	134	222	2.4e-12	47.4
TkA07G397480	`PF02721`	DUF223	204	244	1.6e-05	25.7
TkA07G397480	`PF10764`	Gin	285	298	0.3	11.8
TkA07G397480	`PF10764`	Gin	301	313	0.3	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card