Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1235 bp · TkA07G396290|TK1151|cDNA
CTACAATGGCTGTCCCTCTTTCAAATCTCACTCCCAGTCTCCTTGTTTCAAAGCTCTGCTTAGGAACGATGACATTCGGTGAGCAAAATTCGCTGTCACAGTCCTTCAAACTTCTCGACAAAGCATTCGATACCGGAATCAACTTCTTCGATTCTGCAGAAATGTATCCAGTTCCACAGCGTGCAGAAACACAAGGACGGAGCGAAGAATACTTTGGTCGCTGGCTTAGAGAGAGAAAAATACCTCGTGATCGTGTCGTA...
1074 bp · TkA07G396290|TK1151|CDS
ATGGCTGTCCCTCTTTCAAATCTCACTCCCAGTCTCCTTGTTTCAAAGCTCTGCTTAGGAACGATGACATTCGGTGAGCAAAATTCGCTGTCACAGTCCTTCAAACTTCTCGACAAAGCATTCGATACCGGAATCAACTTCTTCGATTCTGCAGAAATGTATCCAGTTCCACAGCGTGCAGAAACACAAGGACGGAGCGAAGAATACTTTGGTCGCTGGCTTAGAGAGAGAAAAATACCTCGTGATCGTGTCGTATTTGC...
Protein
Download Protein FASTA357 aa · TkA07G396290|TK1151|PROTEIN
MAVPLSNLTPSLLVSKLCLGTMTFGEQNSLSQSFKLLDKAFDTGINFFDSAEMYPVPQRAETQGRSEEYFGRWLRERKIPRDRVVFATKVSGPSGQMTWIRGGPTSLNSRNIKMAIDNSLLRLQTDYIDLYQIHWPDRYVPMFGETDYDPVRQYTPVGFDEQLDALGTAVDAGKIRFIGVSNETPYGVMKFLQAADNNPSYPRIATIQNSYNLLCRNFNSGLAECCHLERVRLLAYSPLAMGLLSGKYLLPDYGGDDARL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G396290 |
|---|---|
| TK1151 ID | TkA07G396290 |
| OH-1004 ID | LXL04_003437 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 86.500 |
| Protein coverage (%) | TK1151 76.751 / OH-1004 66.760Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G396290 |
|---|---|
| Location | Chr07:99545196-99547388 (-) |
| Description | Similar to tas: Protein tas |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006772 thiamine metabolic process Biological Process GO:0034198 cellular response to amino acid starvation Biological Process GO:1902767 isoprenoid biosynthetic process via mevalonate Biological Process GO:0005829 cytosol Cellular Component GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function |
| KEGG gene cross-reference | bsu:BSU26850 ecj:JW0409 ecj:JW2802 eco:b0419 eco:b2834 ecoc:C3026_02045 ecoc:C3026_15565 sfl:SF2844 sfx:S3042 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00248Aldo_ket_red16-348 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G396290 | PF00248 | Aldo_ket_red | 16 | 348 | 1.5e-69 | 235.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.