TkA07G392600 | RubberDandelionOmics

Gene overview

TkA07G392600

Reference: TK1151 Chr: Chr07 Coordinates: 98571759-98578806 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4288 bp · TkA07G392600|TK1151|cDNA

AGCGGGAAAAGTATAATTTCAAATCCCACATATGTCATTGTTGTTGGTCTTACAGAAAAGACTTATCGCCATTGGAGAAGCCTCTTCAGATCTTACTTCTCGTTCGGCTTCAGCTCCATCTTCAACTTCTCGATTCCGTGTGAAGTCAAAGATCTAGAGATGGGAGTGGAGAATTATCATGTGATAGAGCTTGTAGGCGAAGGGTCTTTTGGTAAAGTATACAAGGGAAGGAGAAAGTATACTGGCCAGACTGTTGCAAT...

CDS

Download CDS FASTA

4125 bp · TkA07G392600|TK1151|CDS

AGCGGGAAAAGTATAATTTCAAATCCCACATATGTCATTGTTGTTGGTCTTACAGAAAAGACTTATCGCCATTGGAGAAGCCTCTTCAGATCTTACTTCTCGTTCGGCTTCAGCTCCATCTTCAACTTCTCGATTCCGTGTGAAGTCAAAGATCTAGAGATGGGAGTGGAGAATTATCATGTGATAGAGCTTGTAGGCGAAGGGTCTTTTGGTAAAGTATACAAGGGAAGGAGAAAGTATACTGGCCAGACTGTTGCAAT...

Protein

Download Protein FASTA

1374 aa · TkA07G392600|TK1151|PROTEIN

SGKSIISNPTYVIVVGLTEKTYRHWRSLFRSYFSFGFSSIFNFSIPCEVKDLEMGVENYHVIELVGEGSFGKVYKGRRKYTGQTVAMKFILKHGKSEKDIQNLRQEIEILRKLKHENIIQMLDSFETPQEFCVVTEFAQGELFEILEDDKCLPEEEVQRIAKQLVRALHYLHSNRIIHRDMKPQNILICAGGVVKLCDFGFARAMSTNTVVLRSIKGTPLYMAPELVREQPYNHTADLWSLGVILYELFVGQPPFYTNSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G392600`
TK1151 ID	TkA07G392600
OH-1004 ID	LXL04_005959
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.500
Protein coverage (%)	TK1151 18.413 / OH-1004 24.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G392600

Location Chr07:98571759-98578806 (-)

Description Similar to RUK: Serine/threonine-protein kinase RUNKEL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50240`	Plays a role in conventional modes of cytokinesis in meristems and during male gametogenesis but also acts in nonconventional modes of cytokinesis (cellularization) during female gametogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005959 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0000914 phragmoplast assembly Biological Process

GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process

GO:0007224 smoothened signaling pathway Biological Process

GO:0007349 cellularization Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0010245 radial microtubular system formation Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010467 gene expression Biological Process

KEGG gene cross-reference

ath:AT5G18700

hsa:54986

mmu:209012

pon:100173957

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.556

Rank 1 · TkA07G392600 · TK1151

Nucleus0.297

Rank 2 · TkA07G392600 · TK1151

Cell membrane0.145

Rank 3 · TkA07G392600 · TK1151

Golgi apparatus0.135

Rank 4 · TkA07G392600 · TK1151

Lysosome / Vacuole0.084

Rank 5 · TkA07G392600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase59-309 aa

PF07714PK_Tyr_Ser-Thr61-303 aa

PF14531Kinase-like63-115 aa

PF03109ABC165-116 aa

PF01163RIO173-200 aa

PF01636APH79-173 aa

PF08711Med2686-104 aa

PF12330Haspin_kinase117-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G392600	`PF00069`	Pkinase	59	309	1.4e-80	271.2
TkA07G392600	`PF07714`	PK_Tyr_Ser-Thr	61	303	2.1e-47	162.3
TkA07G392600	`PF14531`	Kinase-like	63	115	1.1e-06	28.8
TkA07G392600	`PF03109`	ABC1	65	116	1.6e-06	28.2
TkA07G392600	`PF01163`	RIO1	73	200	0.0031	17.8
TkA07G392600	`PF01636`	APH	79	173	0.0052	17.3
TkA07G392600	`PF08711`	Med26	86	104	0.028	15.0
TkA07G392600	`PF12330`	Haspin_kinase	117	211	0.0011	18.8
TkA07G392600	`PF13095`	FTA2	122	202	0.037	14.4
TkA07G392600	`PF06293`	Kdo	145	192	0.051	13.7
TkA07G392600	`PF10707`	YrbL-PhoP_reg	151	188	0.085	13.2
TkA07G392600	`PF01636`	APH	152	203	0.0052	17.3
TkA07G392600	`PF03109`	ABC1	154	209	1.6e-06	28.2
TkA07G392600	`PF08711`	Med26	154	166	0.028	15.0
TkA07G392600	`PF14531`	Kinase-like	159	287	1.1e-06	28.8
TkA07G392600	`PF17667`	Pkinase_fungal	165	240	0.00073	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2QAV0`	Arabidopsis thaliana	sp\|Q2QAV0\|TIO_ARATH Serine/threonine-protein kinase TIO	60.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card