TkA07G385410 | RubberDandelionOmics

Gene overview

TkA07G385410

Reference: TK1151 Chr: Chr07 Coordinates: 96627554-96628861 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · TkA07G385410|TK1151|cDNA

ATGAACACTCTCGCTCTTTTCTTTCTCTTAATCACCCTTTCAGTTACTCTCTCTAAATCAAACCACCATGTCAATGGTGATAGTGGTTTTACCGCTGATCTTATTCACAGAGATTCACCACTCTCCCCTCTCTACAACCCAACTCATTCTCCATTAAACCGTGTTCAAAATGCTATTATTCGGTCCATTTCTCGAGCTTCTCGTCTTTCAAAACGGGCAGGTTTTACCACCAAAATAGAAGCAGACATTTCCGAAGTCCC...

CDS

Download CDS FASTA

1308 bp · TkA07G385410|TK1151|CDS

ATGAACACTCTCGCTCTTTTCTTTCTCTTAATCACCCTTTCAGTTACTCTCTCTAAATCAAACCACCATGTCAATGGTGATAGTGGTTTTACCGCTGATCTTATTCACAGAGATTCACCACTCTCCCCTCTCTACAACCCAACTCATTCTCCATTAAACCGTGTTCAAAATGCTATTATTCGGTCCATTTCTCGAGCTTCTCGTCTTTCAAAACGGGCAGGTTTTACCACCAAAATAGAAGCAGACATTTCCGAAGTCCC...

Protein

Download Protein FASTA

435 aa · TkA07G385410|TK1151|PROTEIN

MNTLALFFLLITLSVTLSKSNHHVNGDSGFTADLIHRDSPLSPLYNPTHSPLNRVQNAIIRSISRASRLSKRAGFTTKIEADISEVPGEYIMSIKIGTPPVTVLGVADTGSDLTWAQCQPCVNCYKQDNIPYLVPSSSSTYQQISCQSKACEALDENQSSCDSDNICRYKMMYGDRSYTSGDLAIDTFWFGPTPLKNVVFGCGHDNNGTFNENVSGIIGLGGGPLSLVNQLDSVVKGQFSYCLIPQFNGTTNKTSKINFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G385410`
TK1151 ID	TkA07G385410
OH-1004 ID	LXL04_033648
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.700
Protein coverage (%)	TK1151 97.931 / OH-1004 95.364 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G385410

Location Chr07:96627554-96628861 (+)

Description Similar to CDR1: Aspartic proteinase CDR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g33340`	Involved in salicylic acid-dependent inducible resistance responses.	An extracellular aspartic protease functions in Arabidopsis disease resistance signaling.2004 · DOI: 10.1038/sj.emboj.7600086
`At2g35615`	Probable aspartic protease At2g35615.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433
`At5g10760`	Aspartyl protease involved in a homeostatic feedback mechanism regulating systemic immunity.	Contrasting Roles of the Apoplastic Aspartyl Protease APOPLASTIC, ENHANCED DISEASE SUSCEPTIBILITY1-DEPENDENT1 and LEGUME LECTIN-LIKE PROTEIN1 in Arabidopsis Systemic Acquired Resistance.2014 · DOI: 10.1104/pp.114.239665
`At5g10770`	Probably not redundant with AED1 and not involved in restriction of salicylic acid (SA) or systemic acquired resistance (SAR) signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033648 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT2G35615

ath:AT5G33340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.476

Rank 1 · TkA07G385410 · TK1151

Cell membrane0.155

Rank 2 · TkA07G385410 · TK1151

Endoplasmic reticulum0.130

Rank 3 · TkA07G385410 · TK1151

Lysosome / Vacuole0.109

Rank 4 · TkA07G385410 · TK1151

Cytoplasm0.094

Rank 5 · TkA07G385410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026Asp89-427 aa

PF14543TAXi_N90-261 aa

PF14541TAXi_C284-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G385410	`PF00026`	Asp	89	427	2.8e-25	90.1
TkA07G385410	`PF14543`	TAXi_N	90	261	3.6e-51	174.5
TkA07G385410	`PF14541`	TAXi_C	284	428	2.4e-21	76.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6XBF8`	Arabidopsis thaliana	sp\|Q6XBF8\|CDR1_ARATH Aspartic proteinase CDR1	47.000%	Swiss-Prot	Medium
`Q3EBM5`	Arabidopsis thaliana	sp\|Q3EBM5\|ASPR1_ARATH Probable aspartic protease At2g35615	45.800%	Swiss-Prot	Medium
`Q9LS40`	Arabidopsis thaliana	sp\|Q9LS40\|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1	35.100%	Swiss-Prot	Medium
`Q9LEW3`	Arabidopsis thaliana	sp\|Q9LEW3\|AED1_ARATH Aspartyl protease AED1	36.900%	Swiss-Prot	Medium
`Q8S9J6`	Arabidopsis thaliana	sp\|Q8S9J6\|ASPA_ARATH Aspartyl protease family protein At5g10770	32.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card