TkA07G384590 | RubberDandelionOmics

Gene overview

TkA07G384590

Reference: TK1151 Chr: Chr07 Coordinates: 96470906-96476592 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1337 bp · TkA07G384590|TK1151|cDNA

CCCATTTTCTTTTGTCAAATGTGGTAAGCAGATGAAGTTAAAATAGATTAGTTTTGCTATTTAAAGGAAGGTTATAGTTTCCTTTTCCTGGAACCCACACACACCCAAACATATCTCCACACACTCACACACCACCCCTTTCCTTTTCTCTTTCTTCTTTTATTGGTAACGAGACTATTCATCACTGTTATCTCCAAGAATCCACCCCAAATCCATCTTCTTCCTTCCAGAAAAGGTAAAGAAAAACCCACCAAAATCTA...

CDS

Download CDS FASTA

705 bp · TkA07G384590|TK1151|CDS

ATGGCGAGAGAGAAGATAAAGATTAGAAAGATCGATAATATAACTGCAAGGCAGGTGACGTTTTCCAAAAGAAGAAGAGGGCTTCTGAAGAAAGCCGAAGAACTCGCCGTACTTTGTGACGCCGACGTCGCTCTGGTCATCTTTTCTGCCACCGGCAAACTCTTTGAGTATGCTAGTTCCAGTATGCAAGACTTACTCGGGAAATATAAACACCACTCAACTAATAACGTCAATAAAGTTGACTCACCTTCCCTCAATCT...

Protein

Download Protein FASTA

234 aa · TkA07G384590|TK1151|PROTEIN

MAREKIKIRKIDNITARQVTFSKRRRGLLKKAEELAVLCDADVALVIFSATGKLFEYASSSMQDLLGKYKHHSTNNVNKVDSPSLNLQLLESKETRMSKEVLDKNRELSQLRGEDLNGLTLEELQRLESLLEGGLNRVLQTKDERIENEIASLQQKGFQLMEENKLLKQQMLTLTSMGKRPRTTGAELDNTVINPEDQGQSSDSVATNVYSCNSGPPPEDDYSDTSLKLALPFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G384590`
TK1151 ID	TkA07G384590
OH-1004 ID	LXL04_024457
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.100
Protein coverage (%)	TK1151 70.085 / OH-1004 72.124 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G384590

Location Chr07:96470906-96476592 (-)

Description Similar to MADS27: MADS-box transcription factor 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24540`	Transcription activator that mediates floral transition in response to vernalization.	AGAMOUS-LIKE 24, a dosage-dependent mediator of the flowering signals.2002 · DOI: 10.1073/pnas.212624599 AGL24 acts as a promoter of flowering in Arabidopsis and is positively regulated by vernalization.2003 · DOI: 10.1046/j.1365-313x.2003.01671.x An Arabidopsis MADS-box protein, AGL24, is specifically bound to and phosphorylated by meristematic receptor-like kinase (MRLK).2003 · DOI: 10.1093/pcp/pcg092 AGL24, SHORT VEGETATIVE PHASE, and APETALA1 redundantly control AGAMOUS during early stages of flower development in Arabidopsis.2006 · DOI: 10.1105/tpc.106.041798 Direct interaction of AGL24 and SOC1 integrates flowering signals in Arabidopsis.2008 · DOI: 10.1242/dev.020255 AGAMOUS-LIKE24 and SHORT VEGETATIVE PHASE determine floral meristem identity in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03648.x The Arabidopsis floral meristem identity genes AP1, AGL24 and SVP directly repress class B and C floral homeotic genes.2009 · DOI: 10.1111/j.1365-313x.2009.03985.x
`At2g22540`	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0761000`	Probable transcription factor.	OsMADS22, an STMADS11-like MADS-box gene of rice, is expressed in non-vegetative tissues and its ectopic expression induces spikelet meristem indeterminacy.2005 · DOI: 10.1007/s00438-004-1093-6 Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses.2008 · DOI: 10.1111/j.1365-313x.2008.03406.x
`Os06g0217300`	Transcription factor that acts as a negative regulator of brassinosteroid signaling.	Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses.2008 · DOI: 10.1111/j.1365-313x.2008.03406.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0048586 regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G22630

ath:AT3G57230

ath:AT4G37940

dosa:Os02g0579600

dosa:Os02g0731200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkA07G384590 · TK1151

Cytoplasm0.096

Rank 2 · TkA07G384590 · TK1151

Cell membrane0.024

Rank 3 · TkA07G384590 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA07G384590 · TK1151

Plastid0.012

Rank 5 · TkA07G384590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

PF30676CCDC186_middle79-176 aa

PF01486K-box90-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G384590	`PF00319`	SRF-TF	10	57	1.5e-24	85.9
TkA07G384590	`PF30676`	CCDC186_middle	79	176	0.0076	16.6
TkA07G384590	`PF01486`	K-box	90	171	1.3e-13	51.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82794`	Arabidopsis thaliana	sp\|O82794\|AGL24_ARATH MADS-box protein AGL24	56.000%	Swiss-Prot	High
`Q9FVC1`	Arabidopsis thaliana	sp\|Q9FVC1\|SVP_ARATH MADS-box protein SVP	51.400%	Swiss-Prot	High
`Q9XJ66`	Oryza sativa subsp. japonica	sp\|Q9XJ66\|MAD22_ORYSJ MADS-box transcription factor 22	49.100%	Swiss-Prot	Medium
`Q69TG5`	Oryza sativa subsp. japonica	sp\|Q69TG5\|MAD55_ORYSJ MADS-box transcription factor 55	47.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card