Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2256 bp · TkA07G380050|TK1151|cDNA
CCCAACTCCTCCATTTTGCTAAATCCTCATTTTCTCTCTTCAATTCCAGACTCTTCTTTCATCTCTTTCACATACATTTCTTCACTTTGGTTTCCGATCGGACTTTTCCATCAACCTTAGCCGGATTTTTTCTACCGCCGGTGGCTGATCTCATCTGTTACTTACCTTTTCAGAATCAAGAACTTGAGTATATAATTGATGACGAATATTATGATATGACCGATTTTGCCGACAGCCCTTTTCGCGATAACAACAATAAC...
948 bp · TkA07G380050|TK1151|CDS
ATGCTGAGGAATCTTTTATGGGCAACCTCAAAGCACGATCTCTACCTTATGCAAAACTACTCAGTCATGCATTGGTCTTCACTTCTCAAAAGGGGTAAAGAAGTAATTAATGTCGCTATGCCCGTATTACCTACTTTGAAATACCCTGGGTCGTTTTCTCGTTCACTTTCCCGTGTCCAGGTCAGCACAATGGCTGTGAAGGACGACTTGATAGTAGCCGGTGGTTTTCATGGCGAACTAATCTGCAAGTATCTCAACAA...
Protein
Download Protein FASTA315 aa · TkA07G380050|TK1151|PROTEIN
MLRNLLWATSKHDLYLMQNYSVMHWSSLLKRGKEVINVAMPVLPTLKYPGSFSRSLSRVQVSTMAVKDDLIVAGGFHGELICKYLNKPGVSFATKIADDENAITNSVDISYNSSGSIRVMTANNDALIRVFDAKTFTCTDSFTFPWCVNDTSVSPDGKLLAVLGDNTECLLADSQTGKEIGKMKGHLDYSFASAWHPNGQIVATGNQDTTCRLWDVRNLSKSLMVFKGRMGAIRGIRFSNNGRFMAMAEPADFVHVFDTE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G380050 |
|---|---|
| TK1151 ID | TkA07G380050 |
| OH-1004 ID | LXL04_030087 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 99.365 / OH-1004 57.643Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G380050 |
|---|---|
| Location | Chr07:95226748-95232056 (+) |
| Description | Similar to SPBC2A9.03: Uncharacterized WD repeat-containing protein C2A9.03 (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006282 regulation of DNA repair Biological Process GO:0006352 DNA-templated transcription initiation Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0042789 mRNA transcription by RNA polymerase II Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051123 RNA polymerase II preinitiation complex assembly Biological Process GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005669 transcription factor TFIID complex Cellular Component |
| KEGG gene cross-reference | ana:alr2800 mmu:226182 spo:2540276 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF20426NBCH_WD4055-86 aaPF24805EIF3I57-160 aaPF24807WD40_CDC20-Fz59-140 aaPF24814WD40_Prp1964-258 aaPF24796WDR5567-139 aaPF12894ANAPC4_WD4068-142 aaPF25047Beta-prop_TEP1_2nd68-237 aaPF29037DSE1_N104-135 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G380050 | PF20426 | NBCH_WD40 | 55 | 86 | 0.016 | 14.8 |
| TkA07G380050 | PF24805 | EIF3I | 57 | 160 | 7.4e-10 | 39.2 |
| TkA07G380050 | PF24807 | WD40_CDC20-Fz | 59 | 140 | 2.1e-13 | 51.0 |
| TkA07G380050 | PF24814 | WD40_Prp19 | 64 | 258 | 1.2e-20 | 74.4 |
| TkA07G380050 | PF24796 | WDR55 | 67 | 139 | 8.6e-11 | 42.1 |
| TkA07G380050 | PF12894 | ANAPC4_WD40 | 68 | 142 | 1.4e-12 | 48.4 |
| TkA07G380050 | PF25047 | Beta-prop_TEP1_2nd | 68 | 237 | 7.1e-05 | 22.8 |
| TkA07G380050 | PF29037 | DSE1_N | 104 | 135 | 0.00033 | 20.6 |
| TkA07G380050 | PF23609 | Beta-prop_EIPR1 | 104 | 134 | 0.022 | 15.0 |
| TkA07G380050 | PF25174 | Beta-prop_THOC3 | 105 | 287 | 9.7e-25 | 87.8 |
| TkA07G380050 | PF25173 | Beta-prop_WDR3_1st | 106 | 217 | 1.5e-20 | 74.4 |
| TkA07G380050 | PF00400 | WD40 | 106 | 132 | 3.7e-15 | 56.4 |
| TkA07G380050 | PF24782 | WD40_MABP1-WDR62_2nd | 107 | 180 | 1.1e-05 | 25.3 |
| TkA07G380050 | PF23381 | Beta-prop_IFT122_1st | 108 | 139 | 8.2e-17 | 62.1 |
| TkA07G380050 | PF25175 | Beta-prop_WDR5 | 109 | 142 | 4.2e-21 | 76.2 |
| TkA07G380050 | PF25460 | Beta-prop_Aladin | 113 | 164 | 3.8e-07 | 30.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.