TkA07G379320 | RubberDandelionOmics

Gene overview

TkA07G379320

Reference: TK1151 Chr: Chr07 Coordinates: 95054542-95056794 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1560 bp · TkA07G379320|TK1151|cDNA

ATCAGCTGAAATCAATATTTTCAGCTTCTGGCTACAAAAATCTCTTTTTCACCCAAAACCGCACGACTCTGTCTCTGTTCTTGTTCATTTCCATCCCTCACTATAGTCTCTGTTTTCTCTCTTGAAACCCTAGTTATAGCTCATTAATGGAGTTACTATCATCACCATCTCTCAGTTCATACTGCTCCTTCACCTGCAAACAATCCACTTCAACCTCCAAAGAATGCTCTTCCTCCTTCATCAGAATTTCCAACAGAAAA...

CDS

Download CDS FASTA

1245 bp · TkA07G379320|TK1151|CDS

ATGGAGTTACTATCATCACCATCTCTCAGTTCATACTGCTCCTTCACCTGCAAACAATCCACTTCAACCTCCAAAGAATGCTCTTCCTCCTTCATCAGAATTTCCAACAGAAAATCATATTTTCCGCTTAGTCTTAAGTTGACTTCACAAAGGTCGCAACCATCTAACTTCACAGTTGAAGCTGTTGTTGGCGATACAACTGCTGTACCAAATGATTCCACCACAAAATCTAGCACTGAAATTGCCGAATCAAACATCAA...

Protein

Download Protein FASTA

414 aa · TkA07G379320|TK1151|PROTEIN

MELLSSPSLSSYCSFTCKQSTSTSKECSSSFIRISNRKSYFPLSLKLTSQRSQPSNFTVEAVVGDTTAVPNDSTTKSSTEIAESNINDSDDPKMVRICDKLIEVFMVDKPNPGDWRKLLAFSKEWDTIRPHFFERCQEKADKEDDLNMKHKLLRLGRKLKEVDEDVQRHNKLLQVIKNSPSEIGDIVAKRRKDFTQEFFLHLHLVAESYHDNETEQNLIAKVGNKCLAAVQAYDTATESIEAINAAELKFQDIINSPSVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G379320`
TK1151 ID	TkA07G379320
OH-1004 ID	LXL04_030077
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G379320

Location Chr07:95054542-95056794 (+)

Description Similar to At4g37920: Uncharacterized protein At4g37920

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37920`	Uncharacterized protein At4g37920.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030077 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0032544 plastid translation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT4G37920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.921

Rank 1 · TkA07G379320 · TK1151

Mitochondrion0.064

Rank 2 · TkA07G379320 · TK1151

Nucleus0.047

Rank 3 · TkA07G379320 · TK1151

Cytoplasm0.022

Rank 4 · TkA07G379320 · TK1151

Cell membrane0.016

Rank 5 · TkA07G379320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30872At4g37920_M3-34 aa

PF24447RE_BanI80-123 aa

PF26740DUF824693-237 aa

PF03011PFEMP123-203 aa

PF21938CAP_N144-209 aa

PF24447RE_BanI171-276 aa

PF30870At4g37920_C228-254 aa

PF30872At4g37920_M252-317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G379320	`PF30872`	At4g37920_M	3	34	5.4e-33	113.5
TkA07G379320	`PF24447`	RE_BanI	80	123	0.2	12.0
TkA07G379320	`PF26740`	DUF8246	93	237	7e-70	234.3
TkA07G379320	`PF03011`	PFEMP	123	203	0.3	12.4
TkA07G379320	`PF21938`	CAP_N	144	209	0.14	12.9
TkA07G379320	`PF24447`	RE_BanI	171	276	0.2	12.0
TkA07G379320	`PF30870`	At4g37920_C	228	254	1.5e-40	138.2
TkA07G379320	`PF30872`	At4g37920_M	252	317	5.4e-33	113.5
TkA07G379320	`PF30870`	At4g37920_C	257	298	1.5e-40	138.2
TkA07G379320	`PF30870`	At4g37920_C	322	414	1.5e-40	138.2
TkA07G379320	`PF24447`	RE_BanI	354	412	0.2	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WN0`	Arabidopsis thaliana	sp\|Q84WN0\|Y4920_ARATH Uncharacterized protein At4g37920	43.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card