Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2453 bp · TkA07G374510|TK1151|cDNA
CAGAACACAAGTGGGCCATTCGCCATTGTGTACTTCCTCATAAATGGTGAATAACCTCTCCTTGTTTCTTCCGCCCTAAAACCACCGCCACCACCGCAGCTGGCAAGCTTCTCGACAGAAGCTCCAATTAAACATCACTCTGGCCGCCGTAACCGTGGTGAACCCTGGTTGTTCTTCCAAAAAAGTTGGCGGAGCTGCCTCTGATACCACCACTTTTTCAATCTCCGGCCACCGTCTTTTTCTTTTTTCACCATACTCAC...
1890 bp · TkA07G374510|TK1151|CDS
ATGCCGATTCTTTGTTGCTTTCCTTCATTGGGACAAAGGAACAAGAAAAATAAGGAAGAGGATGATGATAATGAAAGGTTGCATGTGAAATTACAACAGTCGGGGAAGCCTATTGACCTTCAGTCAAAGTCAAGGTCAACATTCAGTGTAGATGTCCCCTTCTCTAACGTGAAGGTCGTCAGCCATGAAAGCCCTGTAAAAGCTCAGCTTCAAGCAGAAGAAGACGAAGAAAAAGAAGAAGCATACGAAGGGGAAGATGA...
Protein
Download Protein FASTA629 aa · TkA07G374510|TK1151|PROTEIN
MPILCCFPSLGQRNKKNKEEDDDNERLHVKLQQSGKPIDLQSKSRSTFSVDVPFSNVKVVSHESPVKAQLQAEEDEEKEEAYEGEDEHEKDYNSDHDRHREVFIGKMPMEEHDEYSNTNIDNHQSNSSDTEMNNDGHLSDPGASKPPLESSPKLKRSCSNLEAKRVSSINRIAPCESYEDLQKLGEGSISPVSITSNYSADKVILRKCSSSQILPSKSRKLWWKLLLWSHRNLHEPIKGVQNMLLVTNQQGGYSSDLEPN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G374510 |
|---|---|
| TK1151 ID | TkA07G374510 |
| OH-1004 ID | LXL04_030117 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G374510 |
|---|---|
| Location | Chr07:93967206-93971415 (-) |
| Description | Similar to DNAAF1: Dynein assembly factor 1, axonemal |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003341 cilium movement Biological Process GO:0003356 regulation of cilium beat frequency Biological Process GO:0007368 determination of left/right symmetry Biological Process GO:0035082 axoneme assembly Biological Process GO:0036158 outer dynein arm assembly Biological Process GO:0036159 inner dynein arm assembly Biological Process GO:0044458 motile cilium assembly Biological Process GO:0046600 negative regulation of centriole replication Biological Process GO:0060271 cilium assembly Biological Process GO:0060287 epithelial cilium movement involved in determination of left/right asymmetry Biological Process GO:0060972 left/right pattern formation Biological Process GO:0070286 axonemal dynein complex assembly Biological Process |
| KEGG gene cross-reference | bta:523187 cel:CELE_T09A5.9 hsa:123872 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25013LRR_Zer-1115-133 aaPF13516LRR_6137-144 aaPF12799LRR_4379-407 aaPF23952LRR_EndoS390-427 aaPF13855LRR_8396-451 aaPF12799LRR_4397-436 aaPF00560LRR_1397-416 aaPF13516LRR_6397-407 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G374510 | PF25013 | LRR_Zer-1 | 115 | 133 | 1.0 | 10.2 |
| TkA07G374510 | PF13516 | LRR_6 | 137 | 144 | 3.5e-05 | 24.3 |
| TkA07G374510 | PF12799 | LRR_4 | 379 | 407 | 6.7e-20 | 71.4 |
| TkA07G374510 | PF23952 | LRR_EndoS | 390 | 427 | 0.0034 | 18.3 |
| TkA07G374510 | PF13855 | LRR_8 | 396 | 451 | 5.6e-18 | 65.2 |
| TkA07G374510 | PF12799 | LRR_4 | 397 | 436 | 6.7e-20 | 71.4 |
| TkA07G374510 | PF00560 | LRR_1 | 397 | 416 | 9.1e-09 | 34.5 |
| TkA07G374510 | PF13516 | LRR_6 | 397 | 407 | 3.5e-05 | 24.3 |
| TkA07G374510 | PF23598 | LRR_14 | 397 | 538 | 4.7e-05 | 23.0 |
| TkA07G374510 | PF14580 | LRR_9 | 400 | 504 | 4e-10 | 40.3 |
| TkA07G374510 | PF24048 | LRR_NXF1-5 | 407 | 473 | 0.00014 | 22.2 |
| TkA07G374510 | PF23952 | LRR_EndoS | 417 | 447 | 0.0034 | 18.3 |
| TkA07G374510 | PF12799 | LRR_4 | 419 | 454 | 6.7e-20 | 71.4 |
| TkA07G374510 | PF00560 | LRR_1 | 419 | 430 | 9.1e-09 | 34.5 |
| TkA07G374510 | PF13516 | LRR_6 | 419 | 430 | 3.5e-05 | 24.3 |
| TkA07G374510 | PF25013 | LRR_Zer-1 | 420 | 450 | 1.0 | 10.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.