TkA07G372910 | RubberDandelionOmics

Gene overview

TkA07G372910

Reference: TK1151 Chr: Chr07 Coordinates: 93563034-93564208 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

677 bp · TkA07G372910|TK1151|cDNA

CTATGCCATATAAATAGTCATTAAGTATTTATACTATATCTACTGATTAGGTTATTTTTTATTTATGTTTAGTCTACAATGACAAGTGCAAATCAATGGAGTGTTGGATGTACTGTTATTGAGATGGCAACTGGAAAGCCTGGAAAGCCTCCATGGAGCCAACAATATCAGGTGATGTTTTGTTTAGGTTGCTGCTCTTTTTCATATAGGAACCGAACAACAAAAGCACATCCACCTATACCATACCATCTTTCCATGCC...

CDS

Download CDS FASTA

357 bp · TkA07G372910|TK1151|CDS

ATGACAAGTGCAAATCAATGGAGTGTTGGATGTACTGTTATTGAGATGGCAACTGGAAAGCCTGGAAAGCCTCCATGGAGCCAACAATATCAGGTGATGTTTTGTTTAGGTTGCTGCTCTTTTTCATATAGGAACCGAACAACAAAAGCACATCCACCTATACCATACCATCTTTCCATGCCTACAAACAGCTTTCAGAGAAGAAACTGGTGCACTGGATGCTTCAAGTGTTCAAGTTTTGTACATAATCTCCGTTTTGA...

Protein

Download Protein FASTA

118 aa · TkA07G372910|TK1151|PROTEIN

MTSANQWSVGCTVIEMATGKPGKPPWSQQYQVMFCLGCCSFSYRNRTTKAHPPIPYHLSMPTNSFQRRNWCTGCFKCSSFVHNLRFEAYVGDIIPYALELIQLLIVKSIYKVFCKFSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G372910`
TK1151 ID	TkA07G372910
OH-1004 ID	LXL04_018778
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 94.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G372910

Location Chr07:93563034-93564208 (-)

Description Similar to NPK1: Mitogen-activated protein kinase kinase kinase NPK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At3g06030`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0000919 cell plate assembly Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007254 JNK cascade Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0038066 p38MAPK cascade Biological Process

GO:0042594 response to starvation Biological Process

GO:0043622 cortical microtubule organization Biological Process

KEGG gene cross-reference

ath:AT1G09000

ath:AT1G54960

ath:AT3G06030

cel:CELE_F59A6.1

nta:107796336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.417

Rank 1 · TkA07G372910 · TK1151

Nucleus0.398

Rank 2 · TkA07G372910 · TK1151

Mitochondrion0.184

Rank 3 · TkA07G372910 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA07G372910 · TK1151

Cell membrane0.076

Rank 5 · TkA07G372910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase4-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G372910	`PF00069`	Pkinase	4	65	0.044	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ36`	Arabidopsis thaliana	sp\|Q9FZ36\|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2	50.800%	Swiss-Prot	Medium
`O22042`	Arabidopsis thaliana	sp\|O22042\|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3	54.000%	Swiss-Prot	Medium
`O22040`	Arabidopsis thaliana	sp\|O22040\|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1	46.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card