TkA07G372800 | RubberDandelionOmics

Gene overview

TkA07G372800

Reference: TK1151 Chr: Chr07 Coordinates: 93519166-93521823 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1709 bp · TkA07G372800|TK1151|cDNA

CCAAAACTAATTAGTCATTACAGCAAGAAAACGAGGACGAATTGTCATTTGCAGCCTTGCAGGGGTGAATGGGACATGAGATTTTATATCTAAAATAAGCTCCTTTCCCAAAACATTCCCCCCATTAGTCATGCCCTCAATACTGAAAACCGCCACCACCACGACGGCGACCACCTCCCCCTTTCAGATCCTAAACCACTGACAAAACCCTTTCGCCACTCTAAATTACAACTCTCCCCCTTTTCGAAATAACCCTCTGC...

CDS

Download CDS FASTA

1101 bp · TkA07G372800|TK1151|CDS

ATGGCGAAGAGGGTTTACGAAGTCTGGAAAGGGAGAAATAAATTCTTTCTTGGAGGGAGATTGATCTTCGGTCCAGATGCCAAGTCTTTACTCGCCTCATTTTCAATGATCATTATTCCCGTTATTGTTTTTTGTATATTTGTTGGAAGACATCTTCGCCATGAGTTCCCATCATATAACGCCGGATACGCCATCATTATTGCCGCAATTGTCTTCACAATCTACGATTTGGTGCTACTTCTTCTGACATCCGCACGCGA...

Protein

Download Protein FASTA

366 aa · TkA07G372800|TK1151|PROTEIN

MAKRVYEVWKGRNKFFLGGRLIFGPDAKSLLASFSMIIIPVIVFCIFVGRHLRHEFPSYNAGYAIIIAAIVFTIYDLVLLLLTSARDPGIIPRNLHPPEEEFRYDTSISQETGGRQTPTLQFPRTKEVMVNGITVKVKYCDTCMLYRPPRCSHCSICNNCVERFDHHCPWVGQCIGLRNYRFFFLFVSSSMLLCIYIFSMSALYIKILMDDEKGTVWKAMQESPASVVLMAYCFITLWFVGGLTGFHLYLISSNQTTYEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G372800`
TK1151 ID	TkA07G372800
OH-1004 ID	LXL04_030045
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G372800

Location Chr07:93519166-93521823 (-)

Description Similar to PAT08: Protein S-acyltransferase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24630`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release
`At5g50020`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g26935`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g48760`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At5g41060`	Palmitoyl acyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0019706 protein-cysteine S-palmitoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G26935

ath:AT3G48760

ath:AT4G24630

ath:AT5G41060

ath:AT5G50020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.285

Rank 1 · TkA07G372800 · TK1151

Cytoplasm0.254

Rank 2 · TkA07G372800 · TK1151

Cell membrane0.236

Rank 3 · TkA07G372800 · TK1151

Lysosome / Vacuole0.227

Rank 4 · TkA07G372800 · TK1151

Endoplasmic reticulum0.219

Rank 5 · TkA07G372800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06749DUF121830-86 aa

PF05987DUF89832-75 aa

PF01529DHHC39-83 aa

PF01529DHHC137-262 aa

PF05987DUF898180-286 aa

PF06749DUF1218218-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G372800	`PF06749`	DUF1218	30	86	0.082	14.1
TkA07G372800	`PF05987`	DUF898	32	75	3.3	7.5
TkA07G372800	`PF01529`	DHHC	39	83	7.9e-39	133.5
TkA07G372800	`PF01529`	DHHC	137	262	7.9e-39	133.5
TkA07G372800	`PF05987`	DUF898	180	286	3.3	7.5
TkA07G372800	`PF06749`	DUF1218	218	257	0.082	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB58`	Arabidopsis thaliana	sp\|Q9SB58\|ZDH19_ARATH Protein S-acyltransferase 8	69.100%	Swiss-Prot	High
`Q8VYS8`	Arabidopsis thaliana	sp\|Q8VYS8\|ZDH24_ARATH Probable protein S-acyltransferase 9	65.200%	Swiss-Prot	High
`Q0WQK2`	Arabidopsis thaliana	sp\|Q0WQK2\|ZDHC9_ARATH Probable protein S-acyltransferase 7	59.900%	Swiss-Prot	High
`Q9M306`	Arabidopsis thaliana	sp\|Q9M306\|ZDH10_ARATH Probable protein S-acyltransferase 5	55.900%	Swiss-Prot	High
`Q9FLM3`	Arabidopsis thaliana	sp\|Q9FLM3\|ZDH23_ARATH Probable protein S-acyltransferase 6	59.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card