TkA07G370860 | RubberDandelionOmics

Gene overview

TkA07G370860

Reference: TK1151 Chr: Chr07 Coordinates: 92975052-92978755 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3326 bp · TkA07G370860|TK1151|cDNA

TTTCATTACTGTTCACTGATCATATTGCATTTGACAAATTGTCCACATGTCCAGCGCATAACTTGAATTGACTACAGCGCATTCATCTATAAGATAGAGTTCCTCAATTAAGTAACCAAACAAATTAGACATTCGTCGGCGCCTGTTACAATACGCAGATCCCCTTCTAAAGATTATAATGAACCTCTTCTCATATGGTATCTTGAACGATCTGTTAGCCAAAATGAAATCATTCCCACTTCTTTCTTCCTTCAAAACAA...

CDS

Download CDS FASTA

1908 bp · TkA07G370860|TK1151|CDS

ATGTTACCTAGTACGATAAGAAACTGTAGCAGATTGTTGCGACTCAGGATTGACGGGAATCAGATCACGGGAAACGTGTCGGATGCTTTTGGCGTCTATGATGACTTGGAGTATGTCGATTTGAGTTATAACAAGTTGTATGGCAAGGTATCGAACAATTGGGCTCGGTGTCGCAGCTTAATGGCTCTTAAGATGTCTAACAATAATTTTTCGGGGGTTATACCTGACAATCTTGGAGACTCTGATCAGCTGCAAGAAAT...

Protein

Download Protein FASTA

635 aa · TkA07G370860|TK1151|PROTEIN

MLPSTIRNCSRLLRLRIDGNQITGNVSDAFGVYDDLEYVDLSYNKLYGKVSNNWARCRSLMALKMSNNNFSGVIPDNLGDSDQLQEIDLASNLLTGEIPISLGRLNSLIYLFLHDNRLRGSIPREFGKLLNLGTLNLAKNALTGAIPSEIGDCSRLRILNFSGNYLRDVIPIKLMRLAELQVLDLADNSIIGGLPLEFGKLKRLETLNISHNNLTGSIPSTFIDLSSLITIDISYNELEGRVPNIHIFQLAPFEAIENNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G370860`
TK1151 ID	TkA07G370860
OH-1004 ID	LXL04_030019
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 44.094 / OH-1004 31.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G370860

Location Chr07:92975052-92978755 (-)

Description Similar to MIK2: MDIS1-interacting receptor like kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
`At1g35710`	Probable leucine-rich repeat receptor-like protein kinase At1g35710.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030019 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010449 root meristem growth Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0080027 response to herbivore Biological Process

KEGG gene cross-reference

ath:AT1G17230

ath:AT1G35710

ath:AT3G24240

ath:AT4G08850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860

Rank 1 · TkA07G370860 · TK1151

Endoplasmic reticulum0.085

Rank 2 · TkA07G370860 · TK1151

Cytoplasm0.060

Rank 3 · TkA07G370860 · TK1151

Nucleus0.039

Rank 4 · TkA07G370860 · TK1151

Lysosome / Vacuole0.027

Rank 5 · TkA07G370860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598LRR_142-22 aa

PF29594LRR_SKP23-44 aa

PF13855LRR_84-46 aa

PF12799LRR_411-46 aa

PF00560LRR_112-31 aa

PF13516LRR_612-24 aa

PF25013LRR_Zer-135-67 aa

PF00560LRR_136-55 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G370860	`PF23598`	LRR_14	2	22	3.7e-16	59.5
TkA07G370860	`PF29594`	LRR_SKP2	3	44	0.015	15.3
TkA07G370860	`PF13855`	LRR_8	4	46	1e-25	89.9
TkA07G370860	`PF12799`	LRR_4	11	46	2.2e-16	60.2
TkA07G370860	`PF00560`	LRR_1	12	31	1.1e-28	93.8
TkA07G370860	`PF13516`	LRR_6	12	24	0.048	14.4
TkA07G370860	`PF25013`	LRR_Zer-1	35	67	1.6	9.6
TkA07G370860	`PF00560`	LRR_1	36	55	1.1e-28	93.8
TkA07G370860	`PF13855`	LRR_8	36	94	1e-25	89.9
TkA07G370860	`PF13516`	LRR_6	36	46	0.048	14.4
TkA07G370860	`PF29594`	LRR_SKP2	39	90	0.015	15.3
TkA07G370860	`PF29460`	LRR_NXF2	49	95	0.071	13.6
TkA07G370860	`PF13516`	LRR_6	57	72	0.048	14.4
TkA07G370860	`PF13855`	LRR_8	58	118	1e-25	89.9
TkA07G370860	`PF00560`	LRR_1	59	79	1.1e-28	93.8
TkA07G370860	`PF12799`	LRR_4	63	94	2.2e-16	60.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG8`	Arabidopsis thaliana	sp\|Q8VZG8\|MIK2_ARATH MDIS1-interacting receptor like kinase 2	46.200%	Swiss-Prot	Medium
`Q9LP24`	Arabidopsis thaliana	sp\|Q9LP24\|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710	45.300%	Swiss-Prot	Medium
`Q9SHI2`	Arabidopsis thaliana	sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	40.200%	Swiss-Prot	Low
`Q9LVP0`	Arabidopsis thaliana	sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930	38.900%	Swiss-Prot	Low
`C0LGQ5`	Arabidopsis thaliana	sp\|C0LGQ5\|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card